(data stored in ACNUC7421 zone)

EMBL: CP000478.PE214

CP000478.PE214       Location/Qualifiers
FT   CDS_pept        254353..254949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15918"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER6"
FT                   /protein_id="ABK15918.1"
FT                   /translation="MDSVDSKIRNRIRRCGKGCVVTPRDFLDLGSRKAVDVALHRLVNE
FT                   GSLRRLSRGLYDNPRVDPDLGTLSPTIDSVVNALKGRDKIRLQPSGGYAANLLGLSEQV
FT                   PTKIVFLTDGPKRQVRLGKQLIILKQTTPRTMATAGRVSGLVIQALRQLGQRRVDASVV
FT                   KRLRDQLSTQDKKQLLRDLRYAPAWIADKMRLIAQ"
     gtggacagcg tcgactccaa aatacgtaat aggataagac ggtgtggaaa aggctgcgtc        60
     gtgaccccac gggattttct tgatttgggg agccgcaaag cagtcgatgt ggctttacac       120
     cgcttagtga atgagggatc tctgcgcaga ttgtctcgtg gactctacga caatccacga       180
     gtcgatcccg atcttggcac actttcacct acgattgact cggtagtaaa tgccctgaaa       240
     ggccgtgaca agattcgtct gcaaccatcc ggcggttatg ctgcaaatct tttgggattg       300
     tccgagcagg tacctacaaa gatcgttttc ctcacagatg ggcctaaacg tcaagttcgg       360
     ctcggtaagc agttgataat tctcaaacag acaacccctc gaaccatggc gactgctggc       420
     cgggttagcg gattagtgat acaggcgctt cgtcaactcg gtcaacgccg agttgacgct       480
     tcagttgtga aacgattgcg agaccagctt tctacccaag ataaaaaaca actccttcgt       540
     gatcttcgat atgcaccggc ttggatcgct gacaaaatgc gtttgattgc ccaatga          597
//

If you have problems or comments...

PBIL Back to PBIL home page