(data stored in ACNUC7421 zone)

EMBL: CP000478.PE215

CP000478.PE215       Location/Qualifiers
FT   CDS_pept        254965..255960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15919"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER7"
FT                   /protein_id="ABK15919.1"
FT                   /translation="MERFYGISAEKQRKFCEEAKSIVGYPPITIEKDFWVCFILRELFG
FT                   LQNWGQHLAFKGGTSLSKGWQLISRFSEDVDVVIRRGFLGFPDDHLGSKRREKLRKECG
FT                   RRIQEDLKPTFESRLREVLPDDLEWSLTLEDAIGDPDRSMFFQYPTIFKTEISYLKRIV
FT                   KVELGARSETEPIEDRPIQSYLAEAFPNIFGNSTFFIRTVTARRTFWEKAMLLHEETFR
FT                   PTDKPRKGRLSRHYYDLWCMINKSIGKEALADVELFDRVAQHRKIFFRQSWVNYETLKK
FT                   GSLRLVPPPEQMAEWRKDYEAMREDMFFDDPPPFDQLLEVILAFEEEFNR"
     atggaaagat tctacggaat ttcggctgag aaacaacgaa agttctgtga agaggcaaag        60
     agtatagttg gctatccacc gatcactatc gaaaaggatt tttgggtttg tttcatcctg       120
     cgggaactct ttggtctgca gaattggggt cagcatctgg cattcaaggg gggcacttct       180
     ctttccaaag gatggcagct aatttcaagg ttctccgaag atgttgatgt ggtcataaga       240
     cggggattcc ttggttttcc tgatgatcat ctcggcagta aacgccggga aaaactccga       300
     aaggaatgcg gtaggcgcat acaggaagat ttgaagccga cgtttgaatc tcgattaaga       360
     gaagtgctcc ctgatgatct ggaatggtct ctcacattgg aggatgcaat tggagatcct       420
     gatcgaagca tgttttttca gtatccgact attttcaaaa ccgaaatcag ttacttaaaa       480
     cgcattgtca aagttgaact gggtgctcgg tctgaaaccg aaccgattga agatcgcccc       540
     atacaatcct acttagccga ggcatttcct aatattttcg ggaacagcac attttttatc       600
     aggacagtta ctgcacgtcg gacattttgg gaaaaagcga tgctcttgca tgaggagacc       660
     tttcgaccca cagacaagcc aagaaagggc agactgtcac gccattacta cgacctgtgg       720
     tgcatgataa acaaaagcat tgggaaagaa gctctggccg atgtggaact atttgatcgt       780
     gttgctcagc accgaaaaat tttttttagg cagagttggg taaactatga aaccctcaaa       840
     aaagggagcc tgcgattggt gcctccgccg gagcaaatgg ctgagtggcg aaaggattat       900
     gaggcaatgc gggaggacat gttctttgat gatccacctc cctttgacca attattggaa       960
     gttatcctag cttttgaaga ggaattcaac cgataa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page