(data stored in ACNUC7421 zone)

EMBL: CP000478.PE216

CP000478.PE216       Location/Qualifiers
FT   CDS_pept        256576..259470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0219"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: TPR repeat-containing protein; type I
FT                   phosphodiesterase/nucleotide pyrophosphatase;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ape:APE1182
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15920"
FT                   /db_xref="GOA:A0LER8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER8"
FT                   /protein_id="ABK15920.1"
FT                   /translation="MIYWIMRLHFHSASTRGFAVAKVPDRRVLLIGWDAADWKVIGPLL
FT                   DAGKMPHLDRFINSGVMGNLATLYPDLSPMLWTSIATGKRPFKHGILGFIEPDPHTGGI
FT                   RPITNLSRKTKTIWNILSQTGRKCNVVGWWPSHPAEPINGVMVSNRYQKAVGPLDRPWP
FT                   LVPGTVHPARLVRNLANLRFHPQQLHSGHIHPFVPKFSEIDQDRDHRLESLAKIISECL
FT                   SIEAAALALMHHEPWDFTAVYFDGIDHFCHGFMRYHPPRADWVDERDFELYSRVVESGY
FT                   ILHDIMLGRLLEKAGEDATVLLVSDHGFKSDNLRPRHIPREPAGPAVMHRHYGVFAMKG
FT                   PGIKEDERVYGAGILDVCPTVLSLFGLPVGLDMDGKPLGGAFQDRPGIETIASWDQLEG
FT                   SAGMHGPEMKIDPVDASEAIKQLVALGYIEKPSEDREEAVAETVRELRYNQARSCMDAN
FT                   RYADAVSILEDLVEGWPFEHRFGIQLVTCYQAMGWLADARKLLESLFRRKEEDALASRE
FT                   KLRLFTEERTGKKPEEWSEEELRELRELRGRSSWNPYAVEYLMGSLLFSEGQKEAALDH
FT                   LKRAEAAAPGEPGIHAKLGAVYLRMKRWEDAELSFGKAVALDPDCAEAYRGLALCHLPR
FT                   RRNTDAAQAALEAIGRVYFDPMSHFLLGVALHRLGHIPRALEALKVAVSQNPNFPRAHR
FT                   RLSLIYKNRLQDVERAAIHHALAVEAARRVWNVRRKRVATSREEAAEAIGMRAGIEPVA
FT                   AKVDTCSVPAVSPTCGAVDLRETVVVVTGLPRSGTSMMMQMLAAGGIEPLTDGKREPDA
FT                   LNPKGYFEFEPAKNLQRDASWLPGARGKAVKVVAQLLPHLSPGLDYRVVFMEREMEEVL
FT                   QSQERMLGHRSKEGAVPASGKLKEVFSAQVSAIRKMLASRGIPTLSIAYGDSLEKPRET
FT                   AARVNAFLGGGLDEGRMAAAVDPRLKTVIGAKSA"
     atgatatatt ggatcatgag gctgcacttc cactctgcaa gcacgagagg atttgccgtg        60
     gccaaggttc ccgatagaag ggttctcctc atcggctggg atgccgccga ctggaaggtg       120
     atcggtccgc ttctcgacgc gggcaagatg ccccacctgg atcgcttcat caattcaggg       180
     gtcatgggca atctcgcgac tctctacccc gacctctccc ccatgctgtg gacgtccatc       240
     gccaccggga aaaggccgtt caaacacggc atcctcggat tcatcgagcc ggatcctcac       300
     accggcggca ttcggcccat cacgaacctg tcccggaaga ccaagacaat ctggaatatt       360
     ctcagccaga cgggcaggaa gtgcaatgtc gtcgggtggt ggccttccca tccggcggaa       420
     ccgatcaacg gggtcatggt ttccaaccgg taccagaagg cggtcggccc gctcgatcgg       480
     ccatggcccc tcgtgccggg gactgtgcac cccgcgcggc tggttcgaaa cctcgcgaat       540
     cttcgctttc atcctcagca actccactcc gggcacatcc acccgtttgt tccgaagttt       600
     tccgaaatcg accaggatcg ggaccacagg ctcgagagcc tggcgaagat catcagcgag       660
     tgcctcagca tagaggccgc cgcgctggcc ctgatgcacc acgaaccctg ggacttcacg       720
     gcggtttact tcgacggcat cgaccatttc tgccacggct tcatgcgcta tcaccccccg       780
     cgcgcggact gggtcgacga gcgggacttc gagctctaca gccgggtggt ggagagcggc       840
     tacatcctgc acgacatcat gctgggccgg ctcctcgaga aggcgggaga ggacgcgacc       900
     gtgcttcttg tctccgatca cgggttcaag agcgacaatc tgcggccgcg ccatatcccg       960
     cgggagcccg cgggtcccgc cgtgatgcac cgccattacg gggtttttgc catgaagggc      1020
     cccggaataa aagaagatga aagggtctac ggggccggca tcctggacgt ctgcccgact      1080
     gtcctgagcc ttttcggcct tcccgtgggg ctcgacatgg acggaaaacc cctgggcggg      1140
     gcgttccaag accggcccgg catcgagacc atcgccagct gggaccagct cgaaggctcc      1200
     gcgggaatgc acggtcccga gatgaagatc gatccggtgg acgcgagcga ggccataaaa      1260
     cagctcgtgg ccctgggcta catcgaaaag ccgagcgaag accgggagga ggccgtcgcc      1320
     gagacggtgc gcgagctccg ctacaaccag gcgcgctctt gcatggacgc gaaccgttat      1380
     gcggatgccg tgtcgattct cgaggacctg gttgaagggt ggcccttcga acaccgattc      1440
     ggaattcaac tcgtcacctg ctaccaggcc atgggatggc tcgcggatgc ccggaagctg      1500
     ctggagagcc tttttcgacg aaaagaggaa gacgcgcttg cttcgcggga aaagctccgc      1560
     ctgttcacgg aagagagaac ggggaagaag ccggaggagt ggagcgagga ggaattgagg      1620
     gagctgcggg agctcagggg gaggtcttca tggaatccct atgccgtgga atacctcatg      1680
     ggctccctcc tcttctccga agggcaaaag gaagccgcgc tcgaccacct caaaagggcc      1740
     gaagccgccg ctcccgggga gcccgggatt catgcgaagc tcggggcggt gtacctgcgc      1800
     atgaaacgct gggaggacgc ggagctttcc ttcggcaaag ccgtggcgct cgatccggac      1860
     tgtgccgaag cctaccgagg gctcgccctc tgccatcttc cacggcggcg caacacggat      1920
     gcggcgcagg cggccctcga ggccatcggc agggtttact tcgaccccat gagccatttc      1980
     ctgctgggag tcgccctgca ccggcttggg cacatcccga gggcgctcga ggcgctgaag      2040
     gtcgccgtct cgcaaaaccc gaacttcccc cgggctcatc ggcggctttc cctcatctac      2100
     aaaaaccgcc ttcaggatgt cgaacgggct gcgatacacc acgcactagc cgtcgaggcg      2160
     gcccggcgcg tctggaacgt ccggagaaag agggtcgcga cgtcccggga agaagcggca      2220
     gaggcaatag gtatgcgggc gggaatcgag cccgtggccg cgaaggttga cacatgctcc      2280
     gtgccggcgg tctcaccgac ttgcggcgcg gtggacctgc gcgagaccgt cgtggtggtc      2340
     acgggccttc cacgctcggg cacctccatg atgatgcaga tgctcgccgc cggaggcata      2400
     gagcccctga ccgacggcaa gcgggagccg gatgccctga acccgaaggg ctacttcgag      2460
     ttcgaaccgg caaaaaacct ccagcgggac gcatcgtggc tgccgggcgc caggggcaag      2520
     gcggtgaaag tcgtggcgca gttgctcccc catctcagcc ccggcctcga ctaccgggtg      2580
     gtcttcatgg aacgggagat ggaggaagtc ctgcaatccc aggaacggat gctggggcac      2640
     cggtcgaaag agggggcggt cccggcgagt gggaagctga aggaggtgtt ctccgcccag      2700
     gtttcagcga taaggaagat gctcgcctcg cgcggcatcc ccacactttc cattgcatat      2760
     ggtgacagcc tcgagaaacc tcgggagacg gcggcgagag tcaacgcttt cctcggggga      2820
     ggactggatg agggccgcat ggccgcggcg gtggaccccc ggttgaaaac ggtcatcggg      2880
     gcaaagagtg cttga                                                       2895
//

If you have problems or comments...

PBIL Back to PBIL home page