(data stored in ACNUC7421 zone)

EMBL: CP000478.PE219

CP000478.PE219       Location/Qualifiers
FT   CDS_pept        263940..265433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0222"
FT                   /product="peptidase C1A, papain"
FT                   /note="PFAM: peptidase C1A, papain; KEGG: mma:MM3203
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15923"
FT                   /db_xref="GOA:A0LES1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES1"
FT                   /protein_id="ABK15923.1"
FT                   /translation="MRSPGKYAAWRILCTVSLVVVIGVFFAVSPGVSQAQQLRQAPLNP
FT                   DFLKYREQLGQGRSPLRVTGEGHALGYIPPPIDLSYAKNLPDADSRAAAVEAVTYPATY
FT                   DLRTQHRVTSVRDQGDCGSCWAFATYASVESKLKGASGTGPSTNYSEQHLNATHGFDWA
FT                   ECDGGNDFISMAYLGRWSGPVNEADVPYPYAVDETAAVVRKHIQDVDQIKDRANYTDNN
FT                   RIKAAVTNHGALYISFKWLDTRYNAAKYAYWNNGTSGEGHAVAIIGWNDNYSRTNFKKA
FT                   GTALPGGNGAFLVKNSWGTTWGNKGYFWMSYYDKSLQTGTSFRGIQATSNYKRSYQYDP
FT                   LGWVTSLGVDTTVLWGANIFTARSDAPAIKAVSFYTGAPNTKVTIYVRKNVSATNPKSG
FT                   TQVGAAVTKTIPTMGYHTVVFSTPKAVTAGKKFSVLIKFNTPGFKYPLPVELAAADYSS
FT                   GATASANQSFYSTDGVAWTDITTYDSTCNVCIKAFGRAS"
     atgcgttcac ccggaaagta tgcagcgtgg aggatactct gcaccgtcag cctggtggtc        60
     gtcatcggtg ttttcttcgc ggtgtcgccg ggcgtgtcgc aggcgcaaca gctgcggcag       120
     gcacctttga acccggattt tctgaaatac agggagcagc tcggacaggg aagaagccct       180
     ctgagagtca ccggggaggg acatgccctg gggtacattc cccctcccat cgacctttct       240
     tatgcgaaga acctcccgga tgccgacagc cgggcggccg cggtcgaggc ggtgacctat       300
     ccggcgacct acgacctgcg cacccagcat cgggtcacct cggtcaggga ccagggggac       360
     tgcggttcgt gctgggcatt cgccacctac gcttccgtgg aatccaagct caagggcgct       420
     tccggaaccg gtccgtcgac caactattcc gaacagcatc tcaacgcgac ccacggtttt       480
     gactgggcgg aatgcgacgg cgggaacgat ttcatttcca tggcctacct gggacgctgg       540
     agcggtcccg tcaatgaagc ggatgttccg tatccgtacg ccgtcgatga gacggcggcc       600
     gtggtgagga agcatatcca ggacgtggac cagatcaagg accgcgccaa ttataccgac       660
     aacaacagga tcaaggcggc cgtaaccaat cacggcgctc tttacatttc cttcaaatgg       720
     ctcgataccc gctacaatgc ggccaaatac gcctactgga acaacgggac gagcggcgaa       780
     ggtcatgccg tggccatcat cggctggaac gacaattatt ccagaacgaa cttcaagaag       840
     gccggcaccg cactgcccgg cggaaacggc gcgtttctcg tgaagaacag ctggggaacc       900
     acctggggca acaagggcta cttctggatg tcctactacg acaaatcgtt gcagaccggc       960
     acgtcgttca gggggattca agcgacatct aactacaaac gcagctacca gtacgatccc      1020
     cttggctggg tcaccagtct gggcgtcgac acaacggtgt tgtggggcgc caacatcttc      1080
     accgccagat ccgatgcccc cgcgatcaag gccgtcagct tctacacggg agcaccgaat      1140
     accaaggtga cgatatatgt ccgcaaaaac gtgtcggcga ccaacccgaa aagtgggacc      1200
     caggtcggag cggcggtgac gaagaccatc ccgaccatgg gataccacac ggtcgtcttc      1260
     tccacgccga aggcggtcac tgccggcaag aaattctcgg tcctgatcaa gttcaatacc      1320
     ccgggattca aatatcctct gccggtcgaa cttgccgcgg ccgactattc cagcggcgcc      1380
     accgcctccg cgaatcagag cttctactcc acggacggcg ttgcctggac cgacatcacc      1440
     acctatgatt cgacctgcaa cgtgtgcatc aaggcgtttg gcagggcttc ctga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page