(data stored in ACNUC7421 zone)

EMBL: CP000478.PE220

CP000478.PE220       Location/Qualifiers
FT   CDS_pept        265672..266172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0223"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: sat:SYN_02087 hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15924"
FT                   /db_xref="GOA:A0LES2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES2"
FT                   /protein_id="ABK15924.1"
FT                   /translation="METWSQRDRPVLDIHSHQTGKDPVIEVMKDILRENDMCVLATCAD
FT                   NRPHCSLMAYVTDEAAQTVYMVTLKSTRKYRHVCENPHVSLLVDTRHKSATDRGGTRAL
FT                   TVHGTFHPLSDAAAKEKILAAIRGRHPHLRKLVDDADAEVLAVRVESLQLLEGAYRASY
FT                   ESL"
     atggaaacct ggtcgcagag agaccgtccc gtcctcgata tccactcgca ccaaacgggg        60
     aaagacccag tgatcgaagt catgaaagat atacttcggg aaaacgacat gtgtgtgcta       120
     gccacctgcg cggacaacag gccgcattgt tccctgatgg cctacgtcac cgatgaagcg       180
     gctcagaccg tctacatggt gacgctgaaa tcgacccgga agtatcgaca cgtctgcgaa       240
     aatccgcacg tgagccttct ggtcgatacc cggcacaagt ccgcgacgga ccgtggcggg       300
     accagggcgc tgaccgttca cggcaccttc catccgctgt cggatgcggc agcgaaagaa       360
     aagatccttg cagcgattcg cggcagacac ccgcacctcc gaaaactcgt cgacgacgcc       420
     gatgcggagg tgctggcggt gcgcgtggaa tcgttgcagc tgctggaagg ggcctaccgg       480
     gccagttacg aatccttata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page