(data stored in ACNUC7421 zone)

EMBL: CP000478.PE222

CP000478.PE222       Location/Qualifiers
FT   CDS_pept        complement(267341..267559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15926"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES4"
FT                   /protein_id="ABK15926.1"
FT                   /translation="MVELVDGQKYRLPNGEVVTARLYDGSFILEYRRKYRYPLAVGKDG
FT                   RLFLRGEGMSWTVQDLSPDEEEEQTVN"
     atggtcgaac tggtcgacgg acagaaatac cggctgccca acggggaggt cgtcacggca        60
     agactctacg acggcagctt cattctggaa taccggagaa aataccgcta ccccctcgcg       120
     gtgggcaagg acggccggct ctttctgcgc ggggaaggaa tgagctggac cgtccaggat       180
     ctgtccccgg acgaagaaga ggagcagacg gtcaactga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page