(data stored in ACNUC7421 zone)

EMBL: CP000478.PE225

CP000478.PE225       Location/Qualifiers
FT   CDS_pept        complement(269107..269328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0228"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: gme:Gmet_1063 twin-arginine
FT                   translocation protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15929"
FT                   /db_xref="GOA:A0LES7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES7"
FT                   /protein_id="ABK15929.1"
FT                   /translation="MFSLPELAVILAVVAVVFGPGKLPDIGKSLGKGIRNFKKATDEES
FT                   PVPQVPSKTAPAELEAAERIEQRPASNE"
     atgttcagcc tgccggagtt ggccgtcatc ctggcggtgg ttgcggtcgt tttcggcccg        60
     gggaagcttc ccgacatcgg aaagtccctg ggaaaaggaa tcaggaattt caagaaagca       120
     accgacgagg agtcgccggt tccgcaggtt ccgtccaaaa ccgccccggc ggaattggag       180
     gcggctgagc ggatcgagca aagacccgcc tcgaacgagt ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page