(data stored in ACNUC7421 zone)

EMBL: CP000478.PE227

CP000478.PE227       Location/Qualifiers
FT   CDS_pept        270633..271286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0230"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: dvu:DVU3295 hemolysin
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15931"
FT                   /db_xref="GOA:A0LES9"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES9"
FT                   /protein_id="ABK15931.1"
FT                   /translation="MRYKPRELMNGLTHCIAALLAVAGLVVLMLRAVDPPRPLHLLSFF
FT                   VFGTALILLYLTSTAYHWAQCSVKGLQRLRRLDHIMIFVVIAATYTPICLIPLRGPWGW
FT                   TLFGGIWALACAGVLMKMVWLQTPRWLSTTVYVAMGWLAVVAVYPLYRALQPAAFAWLV
FT                   AGGLFYTAGALVYALKKPDPWPRAFGFHELFHVLVVMGSFSHFWVLYEYVVRID"
     atgagataca aaccgagaga gctgatgaac gggttgacgc attgcattgc ggctctgctt        60
     gccgtggcgg gactggtggt gctcatgctc cgagccgtcg atcctcccag gccgctgcac       120
     ctgctctcct tcttcgtgtt cggaacggct ctgatcctgc tctacctgac aagcaccgcg       180
     taccactggg cgcagtgctc ggtcaaggga ctccagaggc tgcgacgact cgatcacatc       240
     atgatattcg tggtgatagc ggcaacctat accccgatct gtctcatccc tttacgcggc       300
     ccctggggat ggacgctctt cggcggtatc tgggctctgg cctgtgcggg agtgctgatg       360
     aaaatggttt ggctgcagac tccgcgttgg ctctccacga cggtgtacgt cgccatgggc       420
     tggcttgcgg tggtcgcggt ttatcccctg taccgcgcgc tgcagcctgc cgcttttgcc       480
     tggctcgtgg cgggcggact gttctacacg gcgggagccc tggtctatgc cctgaagaaa       540
     cccgatccgt ggcccagggc gttcgggttc cacgagcttt ttcacgttct ggtggtgatg       600
     gggagctttt cccacttctg ggttctatac gaatatgtcg ttcgaatcga ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page