(data stored in ACNUC7421 zone)

EMBL: CP000478.PE228

CP000478.PE228       Location/Qualifiers
FT   CDS_pept        271546..274056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0231"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: gsu:GSU1529 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15932"
FT                   /db_xref="GOA:A0LET0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET0"
FT                   /protein_id="ABK15932.1"
FT                   /translation="MPAWAFRFMPVLTKRSFTDKVQTSVALFRTMKNDTPGGPQWIAPS
FT                   LEGNAVKVSMESPEDAMSECSSLRERVRELESAENPFRTALEDHDELIVRFRPDFTLVY
FT                   ANQAYCRHLADTEAPCVGGNFLDCVNPADHDRVREEIGSLVPDGPVKTVEHGVLLGGRE
FT                   VRLSRWVYRAMIGERTDVIEYLGMSCVQGERIAHPGPWNEYRFLAEKTGNAAYRLRCDS
FT                   RTYDHLGPAITRLTGYPLDEFDVSKFSELIEKIEIPGEEDVTPDTLIGFRKEGRTGEYR
FT                   ADYLIRTRLGERKWVRDHSFPWYDESGGLVGSVGILSDVTECKRAEEALQESEERFRNM
FT                   AGLSPFPIAIVDRNGKIIYLNQRFVDLFGYTASDIPTLWDWFNQACPDPGESRTIIERI
FT                   RSDLQAASKYEVISHEHRVRCKDGSSREIRFRLVSMENGDKFVTCEDLTEHMKIQEERI
FT                   KASKLESIGVLAGGIAHDFNNILTAIIGNISLAKLYGGQGGRVSEKLTEAERACMRAKN
FT                   LTQQLLTFSKGGEPIKKVIDVSDFLHEAVHFVLTGSNVRSVFFLPDDLWPVQCDEGQMG
FT                   QVINNLIINAKQAMPDGGTIEISAENVILNAGDQALPLKPGRYLRIGVKDYGHGIPEEA
FT                   LTRIFDPYFTTKLKGSGLGLATAYSIIKKHEGYIQVESRVGEGAAFHIYLPVAGWSLRE
FT                   HDKMGDDTLRGRGRVLVMDDEDIILNCTYDLLRYLGYEVELARDGAEAVELYQEAVGLS
FT                   RPFDAVIMDLTVPGGVGGVEAMQRLREIDPKVNAIVSSGYSNDPIMSQYREYGFRGVIT
FT                   KPYKLEQIGELLKTIVRRKWDAVE"
     atgccggcat gggccttccg gttcatgccg gttttgacga agcggagctt caccgataag        60
     gttcagacgt ccgttgccct tttccggaca atgaaaaacg acacgcccgg cggtccgcaa       120
     tggattgccc cctccctgga aggaaacgcc gtgaaggttt cgatggaatc gccggaagac       180
     gcaatgagtg aatgcagcag ccttcgggaa cgggtgaggg aactggagtc cgcggaaaat       240
     ccattccgga cggcactgga agatcacgat gagctgattg ttcgtttccg gcccgatttc       300
     acgctcgtgt atgcaaacca ggcctattgc cgacatcttg ccgataccga agcgccgtgc       360
     gtgggaggga atttcctgga ctgcgtcaat ccggccgacc acgatcgggt cagggaggaa       420
     atcggttcgc tggtcccgga tggtcccgtc aagaccgtcg aacacggagt gctcctcgga       480
     ggcagagagg ttcgtttatc ccgatgggtc tatcgcgcca tgatcggtga acggaccgac       540
     gtgatcgaat acctcggcat gagttgtgtc cagggagaac ggatagccca ccccgggcca       600
     tggaacgaat accgctttct tgcggagaag accggcaacg cggcgtatcg gctcagatgc       660
     gattcccgga cctacgatca cctcggtccc gccattacga ggcttaccgg gtacccgttg       720
     gacgagttcg acgtatcgaa gttttccgag ctgatcgaga agattgaaat tccgggggaa       780
     gaggacgtca cgccggatac cctgatcggg tttcggaagg aaggaagaac gggagaatac       840
     agggccgatt acctgatccg gacccgactg ggggaacgca aatgggtgag ggatcattcc       900
     ttcccctggt acgacgagtc gggaggcctt gtgggctccg tcggcatcct atcggacgtg       960
     acggaatgca agcgggcgga ggaggcgttg caggaaagcg aggaacggtt cagaaacatg      1020
     gccggcctct ctccgttccc tattgccatc gtcgaccgga atggaaagat catttacctc      1080
     aaccagaggt tcgtcgatct gttcgggtac actgcaagcg acatcccgac gctgtgggac      1140
     tggttcaacc aggcttgtcc ggaccccggg gaaagccgga cgatcatcga aaggatacgg      1200
     tcggacctgc aagccgcatc gaaatacgag gtcatcagcc acgagcacag ggttcggtgc      1260
     aaggatggtt cgagccggga aatccgattc cgcctggtgt ccatggaaaa cggcgataag      1320
     ttcgtcacct gcgaagacct gaccgagcat atgaagatcc aggaggaacg catcaaggcc      1380
     agcaagctgg aatccatcgg cgttcttgcg ggtggtattg cacatgattt caataatatc      1440
     ctgacagcca tcatcggcaa tatttcactg gcaaaattgt acggcgggca gggcggcagg      1500
     gtctccgaga agttgacgga ggccgagcgg gcatgcatgc gcgcgaagaa cctcacgcag      1560
     cagttgctga ccttctcgaa aggcggggag cccataaaaa aggtaatcga cgtctccgat      1620
     ttcctccatg aagcggtgca ttttgtcctg accggctcga atgtccggag cgtcttcttt      1680
     cttcccgacg acctttggcc cgttcagtgc gatgaaggcc agatggggca ggtgatcaac      1740
     aacctgatca tcaatgccaa gcaggccatg cctgacggag gtacaatcga gatatccgcc      1800
     gagaacgtca tcctcaacgc cggggatcag gctctgccgc tcaagccggg ccgatacttg      1860
     cggatcggag tgaaagatta cgggcatggg ataccggaag aggcactgac gcgcattttc      1920
     gatccctact tcacgaccaa gctcaaggga agcggtcttg ggcttgccac tgcctattcc      1980
     atcatcaaga agcacgaggg atacatccag gtcgagtcgc gagtcggaga aggggccgca      2040
     tttcacatct atctgcctgt ggcgggatgg tctctgcggg agcacgacaa aatgggcgac      2100
     gacacacttc gcggacgggg ccgggtcctc gtcatggatg atgaggacat cattttgaac      2160
     tgcacctacg atcttctgag atacctgggg tatgaagtcg agctcgcccg ggacggggcc      2220
     gaagcggtgg agttgtacca ggaagccgtg gggctgtcgc gtcccttcga tgccgttatc      2280
     atggacttga ccgttcccgg gggggtgggc ggagtcgagg cgatgcaaag gcttcgcgaa      2340
     atcgacccca aggtgaacgc catcgtttcg agcggctact ccaacgatcc catcatgtct      2400
     cagtaccgtg aatacggttt tcggggggtg atcaccaagc cgtacaagtt ggaacagatc      2460
     ggggaactgc tcaaaacaat cgtccggcgc aagtgggacg cggtcgagta a               2511
//

If you have problems or comments...

PBIL Back to PBIL home page