(data stored in ACNUC7421 zone)

EMBL: CP000478.PE232

CP000478.PE232       Location/Qualifiers
FT   CDS_pept        276032..276505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0235"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: chy:CHY_2251 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15936"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET4"
FT                   /protein_id="ABK15936.1"
FT                   /translation="MFSVSEIVDVAIQLERNGERFYRRGIEMVSDDSMRQLLRWLADEE
FT                   VRHREQFAAIKAGFLRREESRAERVGGSILQSAVSDHAFSLDEVDYSSIVDEAMLVDIA
FT                   IGFEKDGITFYEIMQGFIDEPETLALIREISDEERKHIEVLTERKDVLESRAV"
     atgttttcag tgagcgaaat tgtggatgtt gccatccagc ttgaaagaaa tggggagcgt        60
     ttttatcgca ggggcatcga aatggtatcg gatgattcga tgcgccaact tctgagatgg       120
     cttgccgacg aagaggtgcg gcacagggag cagttcgctg ccataaaggc gggttttctg       180
     cgtcgggaag agagccgtgc ggagcgtgtc ggcggctcga tcctgcagag tgccgtttcg       240
     gatcacgcct tttctttgga tgaggtcgac tactcctcca tcgtcgatga ggccatgctg       300
     gtggacattg cgatcggttt cgagaaagac ggcataacct tctacgagat catgcagggc       360
     tttatcgatg aaccggagac tctggcgctt atcagggaaa tcagcgatga ggagcgcaaa       420
     cacatcgagg tactcacgga acgtaaagac gtactggaaa gtcgagccgt ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page