(data stored in ACNUC7421 zone)

EMBL: CP000478.PE233

CP000478.PE233       Location/Qualifiers
FT   CDS_pept        276536..277189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0236"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   dde:Dde_2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15937"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET5"
FT                   /protein_id="ABK15937.1"
FT                   /translation="MDKPFDHYWQLRLSDLKETLEANNFEVFLADNKEQACKLVLERII
FT                   PGIGAKSVSWGGSMTFVATGLYEKVKALPGLEVIDTYDRSIPREEATERRRRALLVDLY
FT                   ITGTNAVTETGKLVNLDMTGNRVASIIFGPRNVILLIGRNKVVPDLEDAMLRVKNFTAP
FT                   VNAMRLDMQTPCVSTSFCEECKSPSRICNTWTITEKSFPKGRIKIVLINEDLGI"
     atggacaaac cgtttgatca ctactggcaa ctcagattga gcgacctcaa ggagactctg        60
     gaggccaaca attttgaggt ttttctggcc gacaacaagg aacaggcctg caagctggtg       120
     ctggaacgaa tcatcccggg aatcggggcg aagtcggttt cctggggagg atcgatgacg       180
     ttcgttgcca cgggattgta cgaaaaggta aaggctttgc ccgggcttga agtgattgac       240
     acgtacgacc gttcgattcc acgggaagag gcgacggaaa ggcgcagacg ggcgctgctg       300
     gtggatcttt acatcaccgg gacaaacgcc gtgacggaaa ccggaaaact ggtgaacctc       360
     gatatgaccg gcaaccgcgt ggcatcgatc atcttcgggc ccaggaacgt gattctcctg       420
     atcggcagga acaaggtggt tccggacctg gaagacgcga tgcttcgcgt caagaatttc       480
     actgcacccg ttaacgccat gcggctggat atgcagacac cctgcgtcag cacgtcgttt       540
     tgcgaggagt gcaagagccc atccaggatc tgcaatacct ggacgatcac ggaaaaatcg       600
     tttcccaagg ggcggatcaa gatcgtcctg atcaatgaag accttggaat ctag             654
//

If you have problems or comments...

PBIL Back to PBIL home page