(data stored in ACNUC7421 zone)

EMBL: CP000478.PE24

CP000478.PE24        Location/Qualifiers
FT   CDS_pept        38113..38562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0025"
FT                   /product="putative ferric uptake regulator, Fur family"
FT                   /note="KEGG: reu:Reut_A0164 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15728"
FT                   /db_xref="GOA:A0LE76"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE76"
FT                   /protein_id="ABK15728.1"
FT                   /translation="MCRQCDYSDLLKRSGVSLTVHRLRVLEVIGDSPCPLSHREIHRTL
FT                   KRSRVVDRVTVYRILDLLVDKGVVQRISSGDRGFRYGLAPSSNHPSHHHFFCSVCGNMQ
FT                   CLDPGALPIDLQALQRSCASLIRNVEVRLDGICGNCLENRGAKDN"
     atgtgccgcc aatgcgatta ttccgatctt ctgaaacgct cgggagtgag cctgacggtt        60
     caccggttga gggtgctgga ggtcatcggg gacagcccgt gtccgctgag tcaccgggag       120
     attcaccgga cgctgaaacg atcccgcgtc gtggaccggg tgacggtcta ccgcatactc       180
     gatcttctcg tggacaaggg ggtcgtccag cggatcagct cgggcgacag gggtttccgg       240
     tacggcctgg cccccagctc gaaccatccc tcccatcatc attttttctg cagcgtttgc       300
     gggaacatgc aatgtctcga tcccggtgcg cttcccatcg atttgcaggc actgcaacgg       360
     tcctgcgcgt ccttgatccg caacgtcgag gtgcgcctgg acgggatatg cgggaactgc       420
     ctggagaatc gcggcgccaa ggataactga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page