(data stored in ACNUC7421 zone)

EMBL: CP000478.PE240

CP000478.PE240       Location/Qualifiers
FT   CDS_pept        284217..285914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0243"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: xac:XAC0422 ABC
FT                   transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15944"
FT                   /db_xref="GOA:A0LEU2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU2"
FT                   /protein_id="ABK15944.1"
FT                   /translation="MTISLKPEHLKRYKDLVWLLVKYGRSDIISQAGLDTIIPEQELPS
FT                   PVVSPKVDELPHDLEKLGPTYIKLGQFLSTRSDLLPPQYLEALSRLQDSAEQFPFEKVE
FT                   EILILELGQRTTREFASFDPVPLAAASLAQVHRAVLRDGRLVAVKVQRPGIRRRVIQDL
FT                   EAFDELAEFLERHLSLAKRFMLQATVAEFRKAVMRELDFRQEAQNLIVLARNLRDYDLI
FT                   VVPTPIEEYSSTRVLTMDYLEGRKLTTIGFTEPLAAERSKLADHLFRAYLQQIFLDGFY
FT                   HADPHPGNLYLTGDGRLALVDLGMVARISGASQQKLLRMMVAIGEGRSEEAAEFAVELG
FT                   EKTLLFDEKRFRKEISDLIIRYQRATIKEIQAGKILLELLKAAGNSGIRFPSEFTMLGK
FT                   TLMNLDAIGRILDPSYDPNAALRRYSGQLLRQRIRKTVSAANVFEMLIDSQDFLRLLPK
FT                   RIGKIIDLVAENRVRMQANVIDEKYLMTGLQKIANRLTLGLILAALIVGAALMMRIRTE
FT                   FTLFGYPGIPILFFLVAVIGSLALVFSIVIHDERVRRMKRPRDEDGEK"
     atgaccattt ccctgaaacc ggagcatttg aaacgctaca aggacctggt ttggctcctg        60
     gtgaagtacg ggaggtcgga catcatcagc caggccggac tggatacgat cattccggag       120
     caggagctgc cctcgccggt agtgagcccc aaggtcgacg aactgccgca tgacctcgaa       180
     aaactcggtc cgacctacat caagctcggc cagttccttt ccacgcgttc ggacctgctg       240
     cctccccagt acctcgaagc gctttcccgc ctgcaggaca gcgcggaaca gttcccattc       300
     gaaaaggtcg aggaaatcct catccttgag ctcgggcagc ggacgaccag ggagtttgct       360
     tccttcgatc cggttcctct cgccgccgcc tccctggccc aggtgcacag ggccgtgctg       420
     cgcgacggca ggctggtggc ggtgaaagtg cagcggcccg gcatcaggcg ccgcgtgatt       480
     caagatctgg aggcgttcga tgagttggcg gaattcctcg agcggcacct ctcccttgcc       540
     aagcggttca tgctccaggc aacggtggcc gaattccgca aggccgtaat gcgggagctc       600
     gatttccggc aggaggctca gaacctgatc gtcctggcca gaaacctgcg ggattacgat       660
     ctcattgttg tgccgacacc gatcgaagag tacagctcga cccgtgtcct cacgatggac       720
     tacctcgaag gccgcaagct gacaaccatc ggtttcaccg aacccctggc tgcggagcgt       780
     tccaagcttg ccgaccacct tttccgggcc tatctgcaac agattttcct ggacgggttc       840
     taccatgccg acccgcaccc cgggaacctc tacctcaccg gggacggcag actggccctg       900
     gtcgacctgg gcatggtcgc gcgcatctcg ggcgccagcc agcaaaaact gctgcgcatg       960
     atggtcgcca tcggggaggg acgcagcgag gaggcggcgg agttcgccgt cgagctcggg      1020
     gaaaagacgc ttctgttcga cgagaaacgt ttccggaagg aaatcagcga cctcatcatc      1080
     aggtatcagc gggccacgat caaggaaatc caggcgggga aaatcctcct ggaactgctc      1140
     aaagccgccg gcaacagcgg aatccgcttc ccctcggagt tcacgatgct cggcaagaca      1200
     ctcatgaacc tcgatgccat cggaaggata ctcgacccct cctacgaccc caatgccgca      1260
     ctcaggcgct attccggcca actgcttcgg cagcggattc gaaaaaccgt ttccgccgcc      1320
     aatgttttcg aaatgctgat cgattcacag gactttctgc ggctgttgcc caagaggatc      1380
     ggcaaaatca tcgacctggt ggctgagaac cgggtcagga tgcaggccaa cgtgatcgac      1440
     gaaaaatatc tcatgacggg actgcaaaag atcgccaacc gcctgaccct cgggctcatc      1500
     ctggccgctc tcatcgtggg agccgcgctg atgatgcgca ttcgcacgga gttcaccctc      1560
     ttcggatatc ccggcattcc gatcctgttc tttctcgttg ccgttatagg cagcctggca      1620
     ctggtattct cgattgtcat ccacgacgaa cgggtaagaa gaatgaagcg gccgcgcgac      1680
     gaagacggcg aaaaatga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page