(data stored in ACNUC7421 zone)

EMBL: CP000478.PE241

CP000478.PE241       Location/Qualifiers
FT   CDS_pept        complement(286140..286481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15945"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU3"
FT                   /protein_id="ABK15945.1"
FT                   /translation="MFELIRKSFLAGLGVVVLTKEKVQEFTRMLVEEGRLSTEEADKLA
FT                   DDLVKSGQRQWDEINAKTQETVKKLVNAVDFVRRKEFQDLTARVEALEQRLGMTADTKE
FT                   ADEPKAEGS"
     atgttcgaat tgatcagaaa gagtttcctg gcgggtcttg gcgttgtggt tctgaccaag        60
     gagaaggtgc aggaattcac ccgcatgctg gtcgaggagg ggaggctttc gaccgaagag       120
     gccgacaagc tggccgacga cctcgtcaag agcggccagc gccagtggga cgagatcaac       180
     gcaaagaccc aggaaaccgt caagaaattg gtgaacgccg tggacttcgt caggagaaag       240
     gaattccagg acctcacggc cagggtcgaa gcactcgaac agcggctcgg catgacggca       300
     gacaccaaag aagcggatga gccgaaagcc gagggaagtt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page