(data stored in ACNUC7421 zone)

EMBL: CP000478.PE244

CP000478.PE244       Location/Qualifiers
FT   CDS_pept        complement(288481..289383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15948"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU6"
FT                   /protein_id="ABK15948.1"
FT                   /translation="MRFSKGYDRKPELLPARPGTATSPRSRTSFLLLVSFLLFTCVFPA
FT                   WASDEKDPWKVLDEGLGVAEFSSSSSDELEYRITVVRIDPRYYAFKLINASENTREKMT
FT                   AREWSRQFNLIAAVNAGMYQEDGLASVGYMKNFDHVNNPRLGRDKTVLAFNPSGPDVPE
FT                   VQIIDRECQDFNSLRQKYRTFVQSIRMISCDRKNVWRQQAGRWSTVAIGTDETGKVLLL
FT                   FCRSPITVHDFIEVLLTLPLSLQRAMYLEGGPQASLYLSTGKTTLERYGSWEPALEQNS
FT                   SIQIPLPVPNVIGIVKKTP"
     atgaggtttt ccaaaggtta tgaccgaaag ccggaattgc tccccgcgcg accgggaacg        60
     gcaacttcgc cccggtctcg gacaagtttc ctgctcctcg tttctttcct gctgttcacc       120
     tgtgtattcc ccgcgtgggc aagcgacgag aaagacccgt ggaaagtcct cgatgaaggt       180
     ctgggggtcg cggagttttc ctcatcgtct tccgatgagc tcgaatacag gatcaccgtg       240
     gtccggatcg acccgcgata ctatgcattc aagctgatca acgcctccga gaacacccgc       300
     gaaaagatga ccgcgcggga atggagccgg cagttcaacc tgattgccgc ggtcaacgcg       360
     gggatgtacc aggaggatgg actggccagc gtgggctata tgaagaattt cgaccacgtg       420
     aacaaccccc gactgggcag ggacaagacc gtgctggcgt tcaatccgtc cggtccggac       480
     gttccggaag ttcagatcat cgacagggaa tgccaggatt tcaacagcct gcgtcagaaa       540
     taccggacct tcgtgcagag catccggatg atctcgtgcg atcggaaaaa cgtctggcgg       600
     cagcaggccg gcagatggag taccgttgcg atcgggaccg atgaaaccgg caaggttttg       660
     ctgctgtttt gccgttcccc gataacggtc cacgatttca tcgaagtcct gctgaccctc       720
     ccgctttcgc tgcagagggc gatgtacctc gagggaggcc ctcaggcatc gctctatctc       780
     tccacgggga aaaccaccct ggaacgatac ggaagctggg agcccgcctt ggaacaaaac       840
     agctccatcc agattccact gcccgtcccg aacgtgatcg gcatcgtcaa gaagactccc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page