(data stored in ACNUC7421 zone)

EMBL: CP000478.PE246

CP000478.PE246       Location/Qualifiers
FT   CDS_pept        complement(290425..292389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15950"
FT                   /db_xref="GOA:A0LEU8"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU8"
FT                   /protein_id="ABK15950.1"
FT                   /translation="MYEDKELKEYRDLLKPPEKFEEGFGWKSIVGAIFIGFLMMPGSMY
FT                   LGLVVGTGIGPAARWVTIILFAEIAKRAYTRLSQQEIFVLYYMAGAALASPFSGLLWNQ
FT                   YLVQSEAARMLGLTQHIPAWIAPQPGSEALVDRTFFHRDWLIPVLLMVGFELISAVDHF
FT                   GLGYALYRLTSDVEKLPFPMAPVGALGNMALAESTEKEESGWKWRVFSVGGMIGLAFGA
FT                   LYVLLPAASGVILSEPIRLFPIPWIELTHATEDFLPAVATGIQLDLGLLFLGMVLPFWA
FT                   VIGGGVGLIITMVANPILYNYGILHRWHKGMGTVDTVFANNFDFYMSFSIGLGLAIAVI
FT                   GIVHVSISFRQKYQGTLKERFRVLFSPPPGRGDFSVWIAIAIYVVSTTAYVILSSLLVP
FT                   GFPWIFLVAYGFIYTPIISYVSARMEGIAGQFVSLPMVREASFIAASRFFGYTGIGIWY
FT                   APIPFHNYGKATVRWREIELTGTSFRSIIKAEILVIPVVLIASLLFSQYIWKLAPIPST
FT                   QYPYAQELWHLQALNSLLLQSATLEGNSPFFQALKLNYLGWGMGLGMATYWLLAALRLP
FT                   VMLIYGVTRGIGQTTPHGIILEILGALLGRYYFTKKYGLSWRQYAPVLLAGFSCGMGLM
FT                   GMLAMGFTLIMRSLRSMAY"
     atgtacgagg acaaggaact taaagaatat cgcgatctcc tgaaaccgcc ggagaaattc        60
     gaggagggat ttggctggaa atccatcgtc ggagcgatct tcatcggttt tctgatgatg       120
     cccggatcga tgtacctcgg cctcgtggtg ggcaccggca taggtccggc cgctcgctgg       180
     gtgaccatca ttctgttcgc cgaaatcgcc aagcgcgcct atacccgttt gagccagcag       240
     gagattttcg tcctctacta catggcgggc gccgcgctcg ccagtccttt ctcgggtctg       300
     ctctggaacc agtacctggt ccagtccgaa gccgcccgca tgctcgggct cacccagcac       360
     atccccgcgt ggatcgcccc gcagccgggc tccgaagccc tggtggatcg cacgttcttc       420
     caccgcgatt ggctcatccc ggtcctgctc atggtgggct tcgagctcat ttcggcggtg       480
     gatcacttcg gcctcggcta cgccctttac cggctcacct ccgacgtgga gaaactccca       540
     tttcccatgg cgccggtcgg cgctctcggg aacatggccc tggccgaatc gacggagaag       600
     gaggagtctg gttggaaatg gcgggtattc tcggtgggag gaatgatcgg tcttgccttc       660
     ggggcgctct acgtcctcct tccggccgca tcgggagtca tactttcgga gccgatccgg       720
     ctcttcccca ttccctggat cgagctcacc cacgccacgg aagactttct gcccgcggtc       780
     gccacaggta ttcaactgga cctcgggctg cttttcctgg ggatggttct gcccttctgg       840
     gcggtgatcg gcggaggagt gggcctgatc atcaccatgg tcgcaaaccc gatcctttac       900
     aactacggca tcctgcatcg ctggcacaaa ggcatgggga cggtcgatac ggtcttcgcc       960
     aacaacttcg acttctacat gagcttcagt atcgggctgg ggctggcgat cgcggtcatc      1020
     ggcatcgtcc acgtctccat cagcttcagg caaaagtacc agggcaccct caaggagcgg      1080
     ttccgggtgc tgttctcccc tccccccgga cgcggcgatt tcagcgtctg gatcgccatc      1140
     gccatctatg tcgtctcgac caccgcctac gtcattctct cctcgctgct ggttccgggt      1200
     tttccatgga ttttcctggt ggcttacggt ttcatctaca cgcccatcat ctcgtacgtt      1260
     tcggcccgga tggagggcat cgccgggcag ttcgtgagtc tgcccatggt cagggaggca      1320
     agcttcatcg ccgcgtcccg cttcttcggg tacaccggca taggcatctg gtacgccccc      1380
     attccgttcc acaactacgg gaaggcgacg gtgaggtgga gggagatcga gctgaccggc      1440
     accagtttca ggagcatcat caaggcggaa atcctggtga tacccgtggt cctcatcgcg      1500
     agcctccttt tttctcagta tatctggaaa cttgcgccta ttccttcaac ccagtaccct      1560
     tatgcgcagg aactctggca cctccaggcg ctcaacagcc tgctgcttca gagcgccaca      1620
     ctcgaaggga attccccctt cttccaggcg ctcaagctca attacctggg ctggggaatg      1680
     ggactcggaa tggccaccta ttggctgctc gccgcattgc gcctgccggt catgctgatc      1740
     tacggagtga ccaggggaat cggtcaaacc acgccgcacg gaatcatcct ggagatcctc      1800
     ggcgccctgc tcggccgcta ctacttcacg aaaaaatacg gcctgtcctg gcgacaatac      1860
     gcccccgtac tcctggccgg tttttcgtgc ggcatgggac tcatgggcat gctcgccatg      1920
     ggtttcacgc tcatcatgcg atctctgcgc agcatggcct actga                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page