(data stored in ACNUC7421 zone)

EMBL: CP000478.PE248

CP000478.PE248       Location/Qualifiers
FT   CDS_pept        complement(294563..299332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0251"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dps:DP1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15952"
FT                   /db_xref="GOA:A0LEV0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV0"
FT                   /protein_id="ABK15952.1"
FT                   /translation="MPTDAKTRSGFNRAARIVLLAWLTACPLWSGLFPGVGYGREVMDH
FT                   VAFFTDLKDRSAGSPGSDAAADYILDFFKKAGLSEVASQQFLTPVPEVVSASIEAEGRT
FT                   VNLYPWGPNLVYLPMTPENGLRGQLIYAGRGDFKDFDRTRLYESIVLMDMESSGNWINA
FT                   ASFGAAAIVFIGRDDSVKGQFEEKDTRTPLTIPRFWVPAGDGEALKRLAMEKTPQAVVK
FT                   SKTRWQNKLVRNCYGLLKGSDPKLRKEMVVVDAAYDASFRVLGLAPGADEATSVAALLI
FT                   LAEEFSRHPPARSVLFVATVGNNESHDGMRHLIWSVKTKKKSLKKLTNQLKDTKARIDD
FT                   QYDLLEKGRYLEQEKPADRESILEILVEKAKDRADALSREIQYRRSASALELAEAQEGP
FT                   RAYRQIAMVNDIGRLTAQQRELAVQLLDEAVEDRRATHKELKVRVQAMKSSTALRGLLE
FT                   EYTQVLFFDLHLSSHYETLGLIETGETFPVRESIRKISRAGRLIGLFTQSGRETAAETG
FT                   IPDIFRDTSRGASPEEISVRAGSVCHPASDVASIAGLPAVSLVSLEDRRLLWSTPADTL
FT                   DRMDRKKVETLSGFLPPALRRLFSEPSLKSAVDAGVSGLSNLEGQAMFIRQGELFPDQP
FT                   ASGTIISILQGDSVFRTMVLRDGTYFMPGLANKRVSLEKLILEPYGIDPATGRIGIAAD
FT                   KAKTGKENYRISVKSDLASAPLIMFRCLQTDILPIFNPRNMGYLTKLELIDAATEAPPL
FT                   RHWYSRVDGRDTMSISLFLEKGTRFKLIMSESLLGKEFFLLNGIPENPNGIGFLVGEPP
FT                   TVSVAPYHVAKDLYSLVGGRLRNLFQHGIVNVHLEELYRQAGTELEQGILALSEHRYGD
FT                   FWDRVATAWAKLDIVYAEVEGNQRDVLGGVMFFIALFVPFAYCMERYIFCFRGIYQQIV
FT                   AFFLILIMTILAIRGLHPAFQLTYSPMVVIIAFFIVGLSLLVSAIIFIRFEKEMEDLQT
FT                   RQAHLRTPQASKWQAFGAGFSIGVSNLNRRKLRTGLTCVTLIILTFTVMSFTNVKSLHR
FT                   STLTRIAEDNPYEGVLLRHQFRLPMTMLTLEDMKARFGPEGASIWPRGWIEPAGLTERT
FT                   ISAVYASGRHAPVEGLLGLGPSAPEVFTRLVTKGRWLNETDDRAVLLPLAMAARLGLDP
FT                   ERDLNVPVEIMGARFTVVGFFDGSALDEAKDLDRHPITPAYLEVSHGEELSEVEIEAMQ
FT                   TGEELLPQTERFRYAAGNRTVIMPFAKCVEYGGKLKAVSILPRSSPTEIADRLSTWLAY
FT                   PLFVGENGTWYHSASTTLRYSGVANLLVPILIVIFITLNTMIGHVHERQKEISTYTSVG
FT                   LAPTHVGFLFIVEALSLAVISTVLGYILAQLSAKYLGNTAMFSQLTFNYSSLASVACMF
FT                   LVFSVVFLAALYPARLAAQIAMPDVNRSWTLPAPEGDVIHMNLPFLLKAEEEAGIMKFL
FT                   KAFYGSHQDVAHGSFIVDEIDMDDALPPVRPGQNPIPVCIVIRTNAWLAPFDFAIKQRV
FT                   HLHCCPSEENPGYLEIAIQMTRISGERSAWVRANNSFIKALRKQMLLWRLLDADTKAIY
FT                   YLPEQSETAG"
     atgcccacgg acgcaaaaac caggtccggt ttcaatcgcg cggcccggat cgtgttgctc        60
     gcctggttga cggcgtgtcc gctgtggagc gggctcttcc ccggcgtggg atacggccgg       120
     gaggtgatgg accacgtcgc cttcttcacc gatttgaaag accggtccgc ggggagcccg       180
     ggaagcgatg ccgcagccga ctacatcctc gactttttca aaaaagccgg tctctccgag       240
     gttgcctccc agcaattcct gacccctgtt cccgaggtcg tttccgcgtc catcgaagcc       300
     gagggccgaa cggtgaacct ctatccatgg gggcccaacc tggtctatct gccgatgacc       360
     ccggaaaacg ggctccgcgg tcagctcatc tacgccgggc ggggggattt caaggacttc       420
     gacaggaccc gtctttatga gagcatcgtg ctcatggaca tggagtcctc ggggaactgg       480
     atcaacgccg catccttcgg cgccgccgcc attgtgttca tcgggcgaga cgactcggtg       540
     aaaggacaat tcgaggagaa agacactcga actcccctga ccatcccgag gttctgggtg       600
     ccggcaggcg atggcgaggc gctgaaacgg ctcgccatgg aaaagacgcc ccaggcggtc       660
     gtcaagtcca agacccggtg gcaaaacaag ctggtccgca actgctacgg cctactcaaa       720
     ggcagcgatc cgaagctgcg gaaggaaatg gtcgtggtcg acgccgccta cgacgcctct       780
     ttccgagtgc tcggactggc tcccggcgcg gacgaagcca catccgtcgc cgctttgctc       840
     attcttgccg aggaattctc ccggcacccg ccggcacgct ccgtgctctt cgtggccacc       900
     gtgggaaaca acgagagtca cgacggcatg aggcacctga tctggagcgt caagaccaag       960
     aagaaatcgc tcaagaaact gaccaaccag ttgaaggaca cgaaagcacg gatcgacgac      1020
     cagtacgatc ttctggaaaa gggccggtat ctcgaacagg aaaaacccgc cgaccgcgag      1080
     tccattctgg aaatcctggt tgaaaaggcg aaggaccggg ccgacgcgtt gagtcgggaa      1140
     atccaatacc gcagatcggc gtcggccctc gagctcgcgg aggcacagga agggccgcgc      1200
     gcctaccgcc agatcgcgat ggtcaacgac atcggaaggc tgaccgcgca acagcgcgag      1260
     cttgccgtgc agttgctgga tgaagccgtg gaggaccggc gggcgactca caaggagctc      1320
     aaagtccgcg tgcaggccat gaaatcttcc accgccttgc ggggactgct cgaggaatac      1380
     acccaggttc ttttcttcga ccttcacctg tcttcgcatt acgaaacctt gggtttgatc      1440
     gaaacgggcg agaccttccc cgtcagggaa agcatcagga agatttcgcg ggccggccgg      1500
     ctcatcggcc tgttcacgca aagcgggcgc gagactgcag ccgagaccgg cataccggac      1560
     atcttccgag acacatcccg gggcgcctcc ccggaggaga tttcggtccg ggccggcagt      1620
     gtgtgccatc ccgcaagcga cgtggcgagc atcgcgggac ttcccgccgt ttccctcgta      1680
     tccctcgagg atcgtcgcct gctctggtcc acgcccgccg atacgctgga ccgcatggac      1740
     cgaaagaagg tcgagaccct gtccgggttc ctgcccccgg cgttgcggcg cctcttttcc      1800
     gagccttccc tgaagtcggc cgtcgatgcg ggggtaagcg gcctctcgaa cctcgagggg      1860
     caggccatgt tcatacggca gggcgagttg tttcccgacc agccggcttc gggaacgatc      1920
     atctccatac tgcagggcga ttcggtcttc cggacgatgg tccttcgaga cggcacgtac      1980
     ttcatgcccg ggcttgccaa caagcgggtt tccctcgaaa aactgatcct ggaaccgtac      2040
     ggcatcgatc cggccacggg aaggatcggg atcgccgcgg acaaagccaa gacgggcaag      2100
     gagaactacc ggatcagcgt caagagcgac ctggcatccg ccccgctgat catgttccgg      2160
     tgcctccaga cggacattct gcccatattc aacccgcgca acatggggta cctgaccaag      2220
     ctcgaactga tcgacgccgc caccgaggcg cctccgctgc ggcactggta cagccgcgtg      2280
     gacggcagag acaccatgag catttcgctg ttcctggaaa aggggacccg tttcaagctc      2340
     atcatgtccg aatctttgct cggaaaggag ttcttcctcc tgaacggcat tcccgagaac      2400
     ccgaacggga tcggatttct cgtaggagag ccgccgaccg tttccgtggc gccctatcac      2460
     gtggcgaaag acctttactc cctggtgggg ggacggcttc ggaacctgtt tcagcacggc      2520
     attgtaaacg ttcaccttga agaactgtac cggcaggccg gcaccgaact tgagcagggt      2580
     atcctggccc tgtcggaaca ccgttacggc gatttctggg accgggtcgc cacggcgtgg      2640
     gcaaagctgg acatcgtcta tgcggaagtc gagggcaatc agcgcgacgt gctcggaggc      2700
     gtcatgttct tcatcgcctt gttcgttccc ttcgcctact gcatggaacg ctacattttc      2760
     tgtttcagag gcatctatca gcagatcgtc gctttcttcc tcatcctgat catgaccatt      2820
     ctcgccatcc gcggcctcca tcccgctttt caactcacct acagccccat ggtggtgatc      2880
     atcgcctttt tcatcgtcgg actgtccctg ctcgtttcgg cgattatttt catccgcttc      2940
     gagaaggaga tggaggatct gcagacccgg caggcccatt tgaggacgcc tcaagccagc      3000
     aagtggcagg ccttcggcgc gggattctcc atcggagtgt ccaacctcaa ccgcaggaag      3060
     ctgcgcacgg gactgacctg cgtcacgctc atcatcctga ccttcaccgt gatgtcgttc      3120
     accaacgtga agagcctgca ccggtcgacg ctcacccgca tcgcggagga caacccttat      3180
     gaaggggtcc tgctgcggca ccagttccgc ctgccgatga ccatgctcac cctggaggac      3240
     atgaaggcgc gtttcggccc ggagggcgca tccatctggc cccgaggctg gatcgagccg      3300
     gccggcctga cggaacggac gatttccgcc gtttacgcat ccggccgtca tgcccccgtg      3360
     gagggtcttc tcggccttgg acccagcgcc cccgaagttt tcacgcgcct ggtgaccaag      3420
     gggcgctggc tgaacgaaac cgacgaccgt gccgttcttc tacctttggc catggccgcg      3480
     cggctgggtc tcgacccgga aagggatctg aacgtcccgg tcgagatcat gggtgcccgc      3540
     ttcaccgtgg tgggtttctt cgatggttcg gccctggacg aagcgaagga cctcgaccgg      3600
     catccgatca ccccggccta cctcgaggtt agccatggcg aggagctttc cgaggtggaa      3660
     atcgaggcga tgcaaaccgg ggaggagctt cttccacaga cggagcgatt ccgctacgcg      3720
     gccggcaatc gcacggtgat catgccgttt gcgaaatgcg tcgaatacgg cgggaagttg      3780
     aaggcggtgt ccattctgcc ccgctccagc ccgaccgaaa tcgccgaccg actctccacg      3840
     tggctggcct accccctgtt cgtcggtgaa aacggcacgt ggtatcacag cgcaagcacc      3900
     accctgcgct acagcggcgt cgccaacctg ctcgtgccca tcctgatcgt cattttcatc      3960
     accctgaaca ccatgatcgg gcacgtgcac gagcggcaaa aggagatctc gacctacacc      4020
     tcggttgggc tggcccccac ccacgtcgga ttccttttta tcgtggaagc cctttccctg      4080
     gccgtcatct cgacggttct aggctacatc ctggcgcagt tgagcgccaa atacctcggg      4140
     aacaccgcga tgttttccca gctcactttc aactattcct cgctggccag cgtcgcctgc      4200
     atgttcctgg tgttttccgt ggtctttctc gccgccctgt accccgcccg gcttgccgcc      4260
     cagatcgcca tgccggacgt caaccgttcc tggacgctgc cggcgcccga gggggacgtc      4320
     atccacatga acctcccctt tctgctcaaa gcggaagaag aggccgggat catgaagttt      4380
     ctcaaggcat tctacggctc ccaccaggat gtcgcccacg gctcgttcat cgttgacgag      4440
     atcgacatgg atgacgccct gccgccggtg aggcccggcc aaaacccgat ccccgtctgc      4500
     attgtgattc gcaccaacgc atggctggca cccttcgatt ttgccatcaa gcagcgcgtt      4560
     cacttgcact gttgcccctc ggaggagaac ccgggatacc tggaaatcgc catccagatg      4620
     actcggattt cgggtgagcg ttccgcctgg gtcagagcaa acaacagttt catcaaggcg      4680
     ttgcgcaagc aaatgctgct ttggcgcctg ctggatgccg acaccaaggc catctactat      4740
     ttgcccgaac agagtgaaac cgccgggtag                                       4770
//

If you have problems or comments...

PBIL Back to PBIL home page