(data stored in ACNUC7421 zone)

EMBL: CP000478.PE25

CP000478.PE25        Location/Qualifiers
FT   CDS_pept        complement(38724..39092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE77"
FT                   /protein_id="ABK15729.1"
FT                   /translation="MVNGDLPYRIPQAVSGHSAIRVNRRRNRHAVSSPAETRGTPRGTQ
FT                   TSPPGPSTPPLRPLRGQRGKKTGTREKGRLRHWKPGLTCSPFRNGRHARFQAHPAGRRK
FT                   SLRPGGSGSDRSFYPKSK"
     atggtgaatg gtgaccttcc gtatcgcatt ccgcaggctg tctcaggaca ctcggcgatc        60
     cgcgtgaacc gccgccgcaa tcggcacgcc gtttcatccc cggcggaaac ccgcgggact       120
     ccgcgcggca cccaaacctc cccgcccgga ccatccaccc cgccgctccg gcccctgcgg       180
     ggccaacgag gcaaaaaaac cggaacccgc gaaaagggca ggctccggca ctggaaaccc       240
     ggtttgacct gctccccttt ccgcaacggg aggcatgccc gtttccaggc acaccctgcc       300
     ggccgccgca aaagccttag acccggcggc tcggggagcg accgttcttt ttatccgaaa       360
     tcgaagtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page