(data stored in ACNUC7421 zone)

EMBL: CP000478.PE250

CP000478.PE250       Location/Qualifiers
FT   CDS_pept        complement(300093..300749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0253"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dps:DP1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15954"
FT                   /db_xref="GOA:A0LEV2"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV2"
FT                   /protein_id="ABK15954.1"
FT                   /translation="MDDRIQRQVVLPFSQLVKISFNSIRVRFFRSLITTLTLALAVAFV
FT                   SFTWSGYELLNAFFPHADGTVQAGILAGGYELENGRFGAGAKDQWLVILSLLVCVVGIV
FT                   NAQLMAVTERFREIGTFKCLGALDSFVVRIFVLESIYQGLFGGFVGGLAGVLIATGSFL
FT                   FRAGWICLACWPPGSMLLTVAGTTLLAVVLSLLGAIYPALVAAKMQPAIALRNEE"
     gtggatgacc ggatacaaag gcaggtggtt ctgcctttca gccagctggt gaagatatct        60
     ttcaattcca ttcgggtgcg gttctttcga tccctgatca ccaccttgac gctggcgctt       120
     gccgttgcct tcgtttcctt cacctggtcc ggttacgagc tgctgaacgc cttctttccc       180
     cacgcggacg gcaccgtcca ggcggggatc ctcgccggcg gctacgagct cgaaaacggt       240
     cgattcggcg ccggcgcaaa ggatcagtgg ctggtgatcc tgtctttgct ggtgtgcgtg       300
     gtgggtatcg tcaacgccca gctcatggcg gtcaccgagc gattccgcga gatcgggacc       360
     ttcaagtgcc tgggagcgct ggacagcttc gtggtgcgca ttttcgtcct ggaatcgatc       420
     taccaggggc tgttcggcgg ctttgtggga gggctggcgg gtgtcctcat cgccacgggc       480
     tcctttcttt tccgggcggg ctggatttgt ctcgcctgct ggcccccggg ctcgatgctg       540
     ctgaccgttg ccggaaccac cctgctcgcc gttgtcctgt ccctgctggg ggcaatttac       600
     cctgccctcg tggccgctaa aatgcagccg gcgatcgccc tgcgcaacga ggaatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page