(data stored in ACNUC7421 zone)

EMBL: CP000478.PE251

CP000478.PE251       Location/Qualifiers
FT   CDS_pept        complement(301178..302302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15955"
FT                   /db_xref="GOA:A0LEV3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV3"
FT                   /protein_id="ABK15955.1"
FT                   /translation="MKIMFYSQHVLGIGHFFRSMELASALANHEVLFVEGGDALPGYVP
FT                   PPHVRRLPLPGLMMDQDFKAIHAVEGTVGETRARRKQLLLGTFLSFRPDVLITELFPFG
FT                   RKQFRFELMPLLECIRQEGMSTGVICSLRDILVEKADQDAYEKGVLEILNAHYHHLMVH
FT                   SDPRIMRLDETFSRVDEIAIPMSYTGFIARKPGRRRRPPRRRTIVVSSGGGKVGVDLLE
FT                   AALTAFRLLPELDAGLRMFIGPFMEAADRNVLASLAARDSRTSIEEFSYDFLDCMAESS
FT                   LSISMAGYNTCMDILSAAVPALVYPFPQNREQMLRARKLEELGFLKVLDGLDPHGMASA
FT                   AAAAMARRKLQSESMPPDLAGAANAALIVEKCLG"
     atgaagatca tgttctacag ccagcacgtg cttggaatcg ggcatttttt cagaagcatg        60
     gagctcgctt cggccctggc gaaccacgag gttctgttcg ttgaaggcgg cgacgctctc       120
     ccgggctacg tcccgccgcc tcacgtaaga aggttgcccc ttcccggcct catgatggac       180
     caggatttca aagcgattca cgccgtggag ggaacggtcg gggaaacccg agccaggcga       240
     aaacaacttc tgctgggcac tttcctgtct tttcgacccg atgtcctgat caccgagctg       300
     ttccccttcg ggcgcaagca gttcagattc gagctgatgc cgctgctgga atgcatccgg       360
     caggaaggca tgtccaccgg ggtgatctgc agcctgcgcg acatcctcgt cgagaaagcg       420
     gaccaggacg cctatgaaaa aggcgtgctc gaaatcctga acgctcacta ccaccacctg       480
     atggttcact ccgacccccg catcatgaga ctcgacgaga ccttcagtcg cgtcgatgaa       540
     attgcgatcc ccatgagcta cacgggattc attgctcgaa aacccggacg acggcgacgg       600
     ccgccgagga gaagaaccat cgtcgtcagc agcggagggg gcaaggtggg agtggatctc       660
     ctcgaggcgg ccttgacggc gttccgtttg ctgcccgagc ttgacgccgg gctgcgcatg       720
     tttatcggtc ccttcatgga agcggcggac cgcaacgtcc tggcaagcct ggcagcccgc       780
     gactccagga cgagcatcga ggaattctcg tacgactttc tcgactgcat ggctgaatcg       840
     agtctttcga tcagcatggc gggctacaac acatgcatgg atatcctgag cgcggccgtg       900
     cccgctctcg tctacccgtt ccctcagaac agggaacaga tgctgcgggc acgcaagctt       960
     gaggaattgg gctttctcaa ggtgctggac gggctcgacc cgcacgggat ggcctcggcc      1020
     gctgcagccg ccatggctcg ccgtaagctc cagtccgaat ccatgccgcc ggatctggcg      1080
     ggcgcggcca atgcagctct catagttgaa aaatgcctcg ggtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page