(data stored in ACNUC7421 zone)

EMBL: CP000478.PE253

CP000478.PE253       Location/Qualifiers
FT   CDS_pept        complement(304391..306253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15957"
FT                   /db_xref="GOA:A0LEV5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV5"
FT                   /protein_id="ABK15957.1"
FT                   /translation="MSELLHSFHIPVMGTAFTIESPFKVARYGISSVISLVDDTLIEKM
FT                   RRFYCRVMGRECTHIRKQDHDSRADRITAYLNLMDEAVKEQFEKLKASAFEMGSEITKY
FT                   FELLPETSPLKQLYKAMQSLKDSVEKRRIQDELRERIKPGAIDVNIMTKVDRHTFDGNG
FT                   EPLPSEFSDALAALRGYARSSVESSIVFSAGFNGRLYGYAEQFDDFHADENGNIKKKIV
FT                   IKVNDYRSALTQGKFFAKKGLWVSEFRLESGLNCGGHAFAHGGALMGPSLEEFRNRKDE
FT                   LIATLFEIYNRALRQKKKRTFDRPHALRITAQGGIGTAGEQSFLLRHYRLDATGWGTPF
FT                   LLVPEATTVDPTTLKRLCEAGREDLFLSDVSPLGVPFNNLRTSLSEEAKRARIRTGKPG
FT                   SPCTKGYLKSNTEFSETPICVASRAYQERKIEQILAGGSDPESARAAIEAVTSKSCLCT
FT                   DLGGTAILTHGLAESEDGPCVPAICPGPGLAYFTRAVSLREMVDHIYGRADIIENRTRP
FT                   NLFISELEMYIDYFDNELRRSLPHPNEQTAKYLREFETNLLEGIAYYQELIPRWSDGPP
FT                   EYRARMKRDLGLCRERLLEVASHFHDMPSLDPDAGLAIGRETAL"
     atgagcgaac tgttacactc gttccacatc ccggtcatgg gaaccgcgtt caccatcgaa        60
     tcgccgttca aggtcgccag gtacggaatt tcgtccgtga tttccctcgt cgacgacacg       120
     ctcattgaaa agatgcggcg tttctactgc cgggtgatgg gccgggagtg cacacatatc       180
     cggaagcagg atcacgattc gcgggctgat cgaatcaccg cctatttgaa cctgatggat       240
     gaggcggtca aggagcagtt cgagaagctc aaagcttcgg cgttcgagat gggcagtgag       300
     atcacgaaat acttcgagct tctcccggag acctcccccc tcaagcaact ctacaaagcc       360
     atgcagtccc tgaaagattc cgtcgagaaa aggcggatac aggacgagtt gcgggagagg       420
     atcaaaccgg gcgccatcga tgtcaacatc atgaccaagg tggatcgcca cacgttcgac       480
     gggaacggag agccgctgcc gtccgagttt tcggacgccc tggctgcgct gcgggggtac       540
     gccaggagca gtgtggaatc ttccatcgtg ttttcagccg gcttcaatgg tcgtctgtac       600
     ggctacgccg agcagttcga cgactttcat gccgacgaaa acgggaatat caagaaaaaa       660
     atcgtcatca aagtgaacga ctatcgttcg gcgctgaccc agggcaaatt tttcgccaag       720
     aaaggcttgt gggtttccga attccgcctg gaatccggcc tcaactgcgg agggcatgct       780
     ttcgcccacg ggggcgccct gatgggaccg agccttgagg aattcaggaa caggaaggac       840
     gaactgatcg cgacattgtt cgaaatttac aaccgggcct tgcgccagaa aaagaagcgc       900
     accttcgacc gtccgcacgc actgcggatc accgcccagg gcggaatcgg cacggccggc       960
     gaacagagct tcctgctccg tcactacagg ctggacgcca cgggctgggg gacacctttt      1020
     ctgctcgttc cggaggccac caccgtggat ccgacaacct tgaagagact gtgcgaagcc      1080
     ggacgggaag acctttttct gagcgatgtg tctccgctgg gggtgccttt caacaacctg      1140
     aggacgtcgc tcagcgagga ggcgaagcgg gcgcggatcc ggacgggtaa accgggaagt      1200
     ccgtgcacca aggggtattt gaaatcgaat acggagtttt ccgaaacccc catttgcgtc      1260
     gcctcgcggg cctatcagga gcgcaagatc gagcaaatcc ttgccggcgg gagcgacccg      1320
     gaatccgccc gagcggcaat cgaagccgtg acttcaaaat cctgcctgtg caccgatctc      1380
     gggggaaccg cgatcctcac tcacggcttg gccgaatccg aggacggccc atgcgtgccg      1440
     gcaatctgtc cggggcccgg actcgcctat ttcaccaggg cggtcagtct ccgggaaatg      1500
     gtcgatcaca tttacggacg cgccgacatc atcgagaatc ggacacgtcc gaacctgttc      1560
     atctccgagc ttgaaatgta catcgactac ttcgacaacg agctgcgccg gtctctcccc      1620
     caccccaacg aacagaccgc gaaatacctc agggagttcg aaacgaacct gctggaagga      1680
     atcgcctatt accaggaatt gatcccccgg tggagcgacg ggccgccgga atatcgggcg      1740
     cggatgaaaa gggatctcgg actctgccgg gaacggttgc tggaggtggc ttcccatttt      1800
     catgacatgc cgtccctcga tcccgacgca ggcctggcaa ttggacggga aaccgctctt      1860
     tag                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page