(data stored in ACNUC7421 zone)

EMBL: CP000478.PE256

CP000478.PE256       Location/Qualifiers
FT   CDS_pept        complement(308896..311082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0259"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein; KEGG: gsu:GSU1871
FT                   ribonucleoside-diphosphate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15960"
FT                   /db_xref="GOA:A0LEV8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV8"
FT                   /protein_id="ABK15960.1"
FT                   /translation="MTLVKKEHPLRMTPNALVVLRKRYLEKDDEGKPIETPEELFWRVA
FT                   RTIAQADVAFQGPEKAEETADRFYALMTSLDFIPNSPTLMNAGRPLGQLSACFVLPVED
FT                   SIDSIFEAIKHAAMIHKSGGGTGFSFSRIRPENDKVLSTQGVASGPVSFMSVFDTATET
FT                   IKQGGTRRGANMGILRVDHPDIEKFITCKTDNDRMTNFNISIAVTDSFMKAVEEDAEYE
FT                   LISPRTRERVQSLSARKVFDEITQSAWRNGEPGIIFLDVMNRHNPTPHVGEIESTNPCG
FT                   EQPLLPYESCNLGSINLASMHRDGNIDYEHLKEVVWDAVHFLDNVIEVNNYPLQIIEDM
FT                   TRGNRKIGLGVMGFSDLLISLGVPYNSEAAVETAEKVMSFIQQESKAASAHYGKERGNF
FT                   VNYAGSIYERPETPHMRNATTTTIAPTGTISIIAGCSSGIEPLFAISFVRKVLDGQELV
FT                   EVHPLFQKVARERGFYSDDLMKKIAEKGSIKNFLEIPADVRNVFVTSHDVTPDWHIRIQ
FT                   AAFQKHTDNAVSKTINFPFSATPEDVSSAYLQAYKLGCKGLTIYRDGSRDVQVLNIQRK
FT                   PQYPQVEPRPRPDRTTGITERVNTGCGKLYVTINSDEYGFCEVFAQMGKAGGCAYSQIE
FT                   ATSRLISLALRSGVKVEAVIRQLVGIRCPSPTWGNGEQVVSCSDAIAKVLNRHAHANVT
FT                   SVGDEMGACPDCGAAVEHEGGCIVCRSCGFSRCS"
     atgaccctcg tgaaaaaaga acatccgttg cggatgacgc ccaacgccct ggtggttctc        60
     aggaaacgtt atctcgagaa ggacgacgaa ggcaaaccga tagagacccc ggaggagctc       120
     ttctggagag tggcgcgcac cattgcccag gcggacgttg cctttcaggg gccggagaag       180
     gcggaggaga ccgcggacag gttctacgcc ttgatgacct cgctcgattt catccccaat       240
     tcaccgaccc ttatgaatgc cggacgtcct ctggggcagt tgtcggcctg tttcgttctg       300
     cccgtggagg attccatcga cagtattttc gaagccatca agcacgccgc catgattcac       360
     aagagcggcg gggggacggg cttttccttc tcgcggatcc gtccggagaa cgacaaggta       420
     ttgtcgaccc agggggtggc gagcggcccg gtgtccttca tgtccgtttt cgataccgcc       480
     acggagacca tcaaacaggg agggacccgt cgcggggcca acatgggcat cctccgggtg       540
     gatcacccgg acatcgaaaa gttcatcacg tgcaagaccg acaacgaccg gatgaccaat       600
     ttcaacatat ccatcgccgt gacggattct ttcatgaagg ccgtggagga ggacgccgag       660
     tacgaactga tcagcccgcg cacgcgtgag cgcgtccagt ccctgtccgc ccgcaaggtc       720
     tttgatgaaa tcacgcagtc ggcgtggaga aacggcgagc cggggatcat cttcctggac       780
     gtcatgaacc ggcacaatcc gacccctcac gtgggcgaga tcgagagcac caacccatgc       840
     ggcgagcagc ccctgttgcc ttatgaatcg tgcaacctgg gttccatcaa tctcgcttcc       900
     atgcatcggg acggaaacat cgactacgaa cacctcaaag aggtggtgtg ggacgcggtt       960
     catttcctgg acaacgtgat cgaggtcaac aactacccgc tgcagatcat cgaggacatg      1020
     accaggggaa accgcaaaat cggactgggc gtgatgggtt tttccgacct gctcatttcg      1080
     ctcggggtcc cgtataattc cgaggctgcg gtggagaccg ccgagaaggt catgtccttc      1140
     attcagcagg aatccaaggc tgcatccgcc cactacggca aggagcgggg caatttcgtc      1200
     aactacgccg gctcgatcta cgaacggccg gaaacgcccc atatgcgcaa cgccaccaca      1260
     acgaccatcg ctccgaccgg cacgatcagc atcatcgcgg gctgttcgag cggaatcgag      1320
     cccctcttcg ccataagctt cgtgcgtaag gtcctggacg ggcaggaact ggtggaagtg      1380
     catcccctgt ttcagaaggt ggccagggag cgcggattct attccgacga cctgatgaaa      1440
     aagattgcgg agaaagggag catcaagaat ttcctggaga tcccggccga cgtgcgcaac      1500
     gttttcgtaa cgtcccacga cgtcaccccc gactggcata tccggattca ggccgcgttt      1560
     cagaaacaca ccgacaatgc ggtcagcaag accatcaatt tccctttcag cgcaaccccc      1620
     gaagacgtca gctccgcata cctgcaggcc tacaagttgg gatgcaaggg cctcaccatc      1680
     tatcgtgacg gcagccggga cgtgcaggtg ctcaacattc agcgcaaacc gcagtacccg      1740
     caggtggagc cccgaccgcg tccggacagg accacgggca tcacggagcg ggtcaacacc      1800
     ggttgcggca agctctatgt caccatcaac tccgatgaat acgggttttg cgaggtcttc      1860
     gcgcaaatgg gtaaagcggg aggctgcgcc tattcgcaga tcgaggccac cagccgcctg      1920
     atttcgctgg cgctgcgctc gggcgtgaag gtcgaggccg tgatcagaca gcttgtggga      1980
     atccgctgcc cgtctccgac ctggggaaac ggcgaacagg tcgtgtcgtg ttccgatgcc      2040
     atcgccaagg ttctcaaccg ccatgctcac gccaacgtca cgtcggtggg cgacgagatg      2100
     ggagcgtgtc cggattgcgg ggccgccgtg gaacatgaag gcgggtgcat cgtctgccgg      2160
     tcgtgcggct tttcgcgctg cagttag                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page