(data stored in ACNUC7421 zone)

EMBL: CP000478.PE259

CP000478.PE259       Location/Qualifiers
FT   CDS_pept        314693..315025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0262"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: sma:SAV7240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15963"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW1"
FT                   /protein_id="ABK15963.1"
FT                   /translation="MVEKRYFMINVKTVTSSSPFLTRNELAVHCGIHPDLIDRFIRLGL
FT                   IDFMDRDSDGEAVFSAEVIPLVRRILRLRNELGVNYAGIGVVLELMARVETLENHIKEL
FT                   ESRIFA"
     atggtggaaa agcgttattt catgatcaat gtcaaaacgg tcacttcctc ttcgccgttc        60
     ctgacccgga acgaacttgc cgtgcattgt ggaattcatc ccgacctgat cgaccggttt       120
     attcgactcg ggctgattga tttcatggac cgcgatagcg atggagaggc cgtgttttca       180
     gccgaagtga ttcctctggt gagaagaatt ctgaggcttc gcaacgaact gggtgtgaac       240
     tacgcgggga taggagtggt gctcgaactt atggcccgcg tggaaacact ggaaaaccat       300
     ataaaggaac tggaaagcag aatcttcgcc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page