(data stored in ACNUC7421 zone)

EMBL: CP000478.PE26

CP000478.PE26        Location/Qualifiers
FT   CDS_pept        39107..39952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0027"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: mta:Moth_0067 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15730"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE78"
FT                   /protein_id="ABK15730.1"
FT                   /translation="MLRKSVLAGAVLVALVCFGFIGVRDGDCAEPQIKDLILATTTSTV
FT                   DTGLLDALIPKFEKETGYRVKTISAGTGQALAMGEKGEADVLLVHAPEAEKKLVDGGMV
FT                   INYQLVMHNDFVIVGPAGDPAGIKGKPSADALKAVAAKEAVFISRGDDSGTHKKEKSLW
FT                   KKVEIQPAGKWYRESGQGMGATLLMASEQQGYTLTDRGTYLAQKKNVKLDILSEGDKAL
FT                   LNIYHVMQVNPEKFAKVNGPGAKAFVEFMVRPDVQKFIGEFGKDKFGQPLFFPDAGKQM
FT                   "
     atgttgagaa aatcggtttt ggctggtgcg gtgctcgttg ccctggtttg tttcggcttc        60
     atcggtgtgc gggacgggga ttgcgcggaa ccccaaataa aggatcttat attggcgacc       120
     accacgtcca ccgtggatac cggactcctt gacgcattga tcccgaagtt cgaaaaagaa       180
     accggatacc gtgtcaagac catctccgcc ggcacggggc aggctttggc aatgggtgag       240
     aagggcgaag cggacgtgct cctggttcac gctcccgagg cggagaagaa gctggttgac       300
     ggcgggatgg tgatcaacta tcagctggtc atgcacaacg acttcgtgat cgtcggcccg       360
     gcgggagacc cggcggggat caaaggcaag ccgagtgcgg atgcgctcaa ggccgtcgcg       420
     gcgaaggaag ccgtgttcat ttcccggggg gacgattccg gcacgcacaa aaaggaaaaa       480
     tctctgtgga agaaggtgga aattcagccc gcagggaaat ggtaccggga atccgggcag       540
     ggcatggggg cgaccctgct gatggcttcc gaacagcagg gatacacgct tacggaccgc       600
     ggaacctacc tcgcccagaa gaagaacgtc aagctcgaca tcctgtccga aggggacaag       660
     gccctgctca acatctatca cgtcatgcag gtgaatccgg agaaattcgc caaggtcaac       720
     ggccccggcg ccaaggcttt cgtcgaattc atggtgcggc ccgacgtcca gaagttcatc       780
     ggtgaattcg gcaaggacaa gttcggtcag ccgctctttt tccccgacgc tggaaagcag       840
     atgtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page