(data stored in ACNUC7421 zone)

EMBL: CP000478.PE260

CP000478.PE260       Location/Qualifiers
FT   CDS_pept        315111..317732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0263"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: pca:Pcar_0359 putative ATPase with
FT                   chaperone activity, two ATP-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15964"
FT                   /db_xref="GOA:A0LEW2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW2"
FT                   /protein_id="ABK15964.1"
FT                   /translation="MDLNKLTIKSQEALKAAETKAIRYGHVEVDVEHLLLALLEQSQGL
FT                   IPSLLRKMDVQVDRLRERLEQELEKKPRVSGPGIEPGKVYITQRLNQLLIKAEEEAGRL
FT                   KDEYVSVEHLLLAFIQEGGATPAGRLLQENRVGKDAFLQTLTSVRGNQRVTSASPETTY
FT                   EALQKYGRDLVQEARTNKLDPVIGRDSEIRRVVRILSRKTKNNPVLIGEPGVGKTAIVE
FT                   GLAHRIVRGDVPEGLKDKAIFALDMGALVAGAKYRGEFEERLKAVLQEIKESEGGILLF
FT                   IDELHTIVGAGKAEGSMDAGNMLKPMLARGELHCIGATTLDEYRKYIEKDAALERRFQP
FT                   VLVDQPTVEDTISILRGLKERYEVHHGVKIQDSALVAAAVLSGRYITDRFLPDKAIDLV
FT                   DEACAMIRTEIDSRPEELDEVMRRVMQLEIEEVALKKEKDKASQERLEALRKEIGELRA
FT                   RTDAMSAQWEAEKQAIKKVQAIREEIEKVRRDIEVAERQFDLQKVAELKHGLMPDLEKK
FT                   LKTEEGGLSADPDGNRLLREEVTEEEIAEIISRWTGIPVTRLVEGEREKLLRLDEVLHR
FT                   RIVGQNEAVSLVADAVIRARSGIKDPRRPIGSFIFLGPTGVGKTELGKALAEALFDSED
FT                   NVVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHPDV
FT                   FNVLLQLLDDGRLTDAQGRTVDFKNTVVIMTSNIGSVYLLDGVTDDGQIKERAREQVMS
FT                   DLRRQFRPEFLNRVDDIVLFKPLTVGEIEKIIDLLTKDLTRRLKDRRIELELTGQAREF
FT                   IARAGYDPVFGARPLKRFLQHNLETRIGRALIAGDIPDGSTIRVDIQDGDLSVTHTVNE
FT                   NE"
     atggatctga acaagctcac gatcaaatcc caggaggcgc tcaaagccgc cgaaacgaag        60
     gcaatccgct acggacacgt ggaagtcgac gtcgaacact tgctcctggc gctgttggag       120
     caatcacaag gactcatccc gagcctgctg cgaaagatgg acgttcaggt cgaccgcctg       180
     agggagcggt tggagcagga gcttgagaaa aaacccaggg tcagcggccc cggcatcgag       240
     cccgggaagg tctacatcac ccagaggctc aatcagctcc tgatcaaggc cgaagaagag       300
     gccggccggc tcaaggacga atatgtatcc gtggaacacc tgctgttggc gttcatccag       360
     gagggcggag ccactcccgc gggcaggctc ctgcaggaaa atcgagtcgg caaggatgct       420
     ttcctgcaga ccctgacctc ggtgaggggg aaccagcgcg ttaccagcgc atctcccgag       480
     accacctacg aggctttgca aaaatacggc cgggacctgg tgcaggaagc ccgcaccaac       540
     aagctggacc cggtgatcgg cagggattcg gaaatccgcc gcgtggtgag gatcctcagc       600
     cgcaagacga agaacaaccc ggtcctgatc ggcgagcccg gagtgggcaa gacggccatc       660
     gtggaagggc tcgctcaccg gatcgttcgg ggcgacgtgc ccgaggggct gaaagacaaa       720
     gccattttcg ccctggacat gggcgccctg gtggccgggg caaagtaccg cggggaattc       780
     gaagagcggc tcaaggccgt gctccaggag atcaaggaat ccgaaggcgg catcctcctg       840
     ttcatcgatg agcttcacac catcgtggga gccggaaagg ccgagggttc catggatgcg       900
     ggcaacatgc tcaagcccat gctcgcccgg ggggaactgc actgcatcgg cgcaaccacc       960
     ctggacgaat accgcaagta catcgaaaaa gatgccgccc tggaacggcg ctttcagccg      1020
     gttctggtcg atcagcccac cgtcgaggac accatctcga tcctgcgcgg gctcaaggag      1080
     cgctacgagg tgcaccacgg cgtcaagatt caggacagcg ccctggtcgc cgcggccgtg      1140
     ctgtccggtc gctatatcac ggaccggttc ctgccggaca aggccatcga cctggtggat      1200
     gaagcctgtg cgatgatccg caccgagatc gattcgcgcc cggaagagct cgatgaggtc      1260
     atgcggaggg tgatgcagct cgaaatcgag gaggtggccc tcaagaagga aaaagacaag      1320
     gccagccagg agcgtctcga ggcgctgcgc aaggaaatcg gcgaattgcg cgcccgcacc      1380
     gacgccatga gcgcccagtg ggaagccgaa aaacaggcga tcaaaaaggt ccaggcgatc      1440
     cgggaggaga tcgagaaggt ccgacgggat atcgaagttg ccgagcggca gttcgacctt      1500
     cagaaggttg ccgaactgaa gcacggcctc atgcccgacc tggagaaaaa gctgaagacg      1560
     gaagaagggg gactgtcggc ggatccggac ggcaaccggc tgcttcgcga agaggtgacc      1620
     gaagaggaga tcgccgagat catctcgcga tggacgggaa ttcccgtgac caggctggtg      1680
     gaaggagagc gcgagaagct gctgcgactc gacgaggtgc tgcaccggcg gatcgtgggc      1740
     cagaacgagg cggtgagcct ggtcgccgac gccgtcatcc gggcgagatc cggaatcaag      1800
     gatccacgcc ggcccatcgg gtcgttcatc tttctcggcc ctaccggagt cggcaaaacc      1860
     gagttgggaa aggcccttgc cgaggcgctg ttcgactccg aggacaacgt ggtccggatc      1920
     gacatgagcg aatacatgga aaagcacgcc gtgtcgcgtc tgatcggcgc tcctccgggc      1980
     tatgtggggt acgaggaggg cggacagctc accgaagccg ttcgcaggaa gccgtattcg      2040
     gtgatcctgt tcgacgaaat cgagaaagcc cacccggacg tcttcaacgt gctcctgcag      2100
     ctcctggacg acggccgtct gacggacgcc cagggccgga cggtggactt caagaacacc      2160
     gtcgtcatca tgaccagcaa catcgggtcg gtctatttgc tcgatggcgt cacggacgac      2220
     gggcaaatca aggaacgggc ccgggagcag gtgatgtccg acctgaggcg ccagttccgc      2280
     ccggagtttc tgaaccgggt cgacgacatc gttctgttca agccgctgac cgtcggtgaa      2340
     atcgagaaaa tcatcgacct gctgaccaag gacctcacca ggaggctcaa agatcggcgc      2400
     atcgagctgg agctcacggg gcaggcgcgc gagttcatcg ccagggccgg gtacgacccg      2460
     gtattcggtg cgcggccgct caagcggttc ctgcaacaca acctggaaac ccgcatcgga      2520
     cgggcgttga tcgccgggga tatccccgac ggctcaacga tccgggttga catccaggac      2580
     ggggacctct cggtgacgca caccgtgaat gaaaacgaat ag                         2622
//

If you have problems or comments...

PBIL Back to PBIL home page