(data stored in ACNUC7421 zone)

EMBL: CP000478.PE267

CP000478.PE267       Location/Qualifiers
FT   CDS_pept        complement(325248..325730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0270"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   tko:TK0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15971"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW9"
FT                   /protein_id="ABK15971.1"
FT                   /translation="MQGLTCFPVGVIRSPYKEIQGMPIQAKGAEGVPGTVELNAELEGG
FT                   LKDLQGFSHIILIYHFHRSEGYSLEVKPFLDDRCHGVFATRAPRRPNPIGISIVRLLKV
FT                   EGNILHIEDVDVLDGTPLLDIKPYIPEFDARETDRIGWLSGKAGRVKETRADDRFK"
     atgcaaggac tgacctgttt tcccgtcgga gtcattcggt ccccctataa ggagatccag        60
     gggatgccca tccaggccaa aggagccgaa ggtgttccgg gaacggtgga gctgaacgcg       120
     gaattggaag gcggattgaa ggacctgcaa ggcttctcgc acattatcct gatctaccat       180
     ttccacagga gcgagggcta ttccctggag gtcaagccct tcctggacga ccgatgccac       240
     ggggtgttcg ccacgcgggc tcccaggcgt cccaatccca tcggcatttc catcgtgaga       300
     cttctgaagg tggaagggaa catcctgcac atcgaggatg tcgacgtgct cgatgggacg       360
     cccctgctgg acatcaaacc ctacatcccg gaatttgacg cgcgggaaac ggacaggatc       420
     gggtggctgt ccggcaaagc cggccgggtg aaagaaacgc gggcggacga tcggttcaaa       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page