(data stored in ACNUC7421 zone)

EMBL: CP000478.PE269

CP000478.PE269       Location/Qualifiers
FT   CDS_pept        327262..327879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0272"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   aba:Acid345_1342 sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15973"
FT                   /db_xref="GOA:A0LEX1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX1"
FT                   /protein_id="ABK15973.1"
FT                   /translation="MRQPDGGCSGRGGQRAMSMDDPDLALVNAAGRGDVDAFESLVGRY
FT                   QGPLLNFIARILGDRGAAEDLAQEVFLRVYRAAPRFEARTKVSTWVFRIAYNLAMTELD
FT                   RRKRRRTLAEALHRNGEEASREALADPGEDREFQEEIASALDGLPGNQRAVLLLRLHQD
FT                   LSYREIAEILGTSLGSVESLLFRARKTLRESLRRRKQQGGTK"
     ttgcggcaac cggatggagg ttgctcgggc aggggcgggc aaagagcgat gtccatggat        60
     gaccctgatc ttgcactggt gaatgccgcg ggccgcggcg acgtggacgc cttcgagtcg       120
     ctggtcgggc gctaccaggg cccgctgctc aatttcatcg ccaggatcct tggggatcgc       180
     ggcgcggccg aagacctcgc ccaggaagtt ttcttgaggg tctatcgcgc ggccccccgg       240
     ttcgaggcga gaacgaaggt ctcgacctgg gtttttcgga tagcctacaa cctggccatg       300
     accgagctcg accgccggaa gcggcggcgg accctggcgg aggcccttca ccgaaacggg       360
     gaggaagctt cccgggaggc tttggccgac ccgggagaag accgcgagtt ccaggaggaa       420
     atcgcatcgg cgctcgacgg actccccggc aatcagaggg cggtgctgct cctgcgcctg       480
     caccaggatt tgtcctatcg ggagattgct gaaatcctgg ggacaagcct cgggagcgtc       540
     gagtctctgc tgttcagagc ccgcaagacc ctgagagaaa gcctgaggag aagaaagcaa       600
     cagggaggga cgaagtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page