(data stored in ACNUC7421 zone)

EMBL: CP000478.PE27

CP000478.PE27        Location/Qualifiers
FT   CDS_pept        39986..40678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0028"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_00838 ABC-type
FT                   tungstate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15731"
FT                   /db_xref="GOA:A0LE79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE79"
FT                   /protein_id="ABK15731.1"
FT                   /translation="MNVISEGIVEAARLLVTLDPDVVAITLRTLQVSTTATFISVLIGL
FT                   PFGTFLALTRFFGRGFVVSLVNFGMGLPPVVVGLVTWLFLTRYGPLGTLGLLYSPTAMV
FT                   IAQAVIASPIVAGFAMAAIQSVNPKLRLQILSLGATRIQFLFLLLWEARLGILAAVIAG
FT                   FGGVISEVGASMMVGGNVRGYTRVLTTATVLEVSKGSFALATGLSIILLALSFGIMASL
FT                   SYLQQRGR"
     ttgaacgtca tttccgaagg catcgtcgaa gcggcaaggc tgctcgtcac tttggacccc        60
     gatgtagtgg ccatcaccct gaggacgctc caggtctcca cgaccgcaac cttcatcagt       120
     gtcctgatcg gccttccgtt cggcactttc ctggccctga cccgattttt cggccgcgga       180
     ttcgtggtga gcctggtcaa cttcgggatg ggacttcccc ccgtggtcgt ggggctcgtc       240
     acgtggctgt tcctgacccg atacgggccg ttgggcacgc tgggtctcct ctattccccc       300
     acggccatgg tcatcgcgca ggcggtcatc gcttcgccca tcgtggcggg gttcgccatg       360
     gcggctatcc agtcggtcaa ccccaagctc cgcctgcaaa tcctgtccct gggagcgacc       420
     cgcatccagt tcctgttcct gctgctctgg gaggcgcgcc tgggcatcct ggccgctgta       480
     atagccggtt tcggcggcgt catcagcgag gtgggcgcgt ccatgatggt gggcggcaac       540
     gtgcgcggct atacgcgcgt gctcactacc gccacggtcc ttgaggtttc caaggggagt       600
     ttcgcgctcg ccacggggct gagcatcatc ctgctggcgc tttccttcgg catcatggcc       660
     tcattgagct acctgcagca aaggggccgg tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page