(data stored in ACNUC7421 zone)

EMBL: CP000478.PE272

CP000478.PE272       Location/Qualifiers
FT   CDS_pept        329068..329865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0275"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_00840 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15976"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX4"
FT                   /protein_id="ABK15976.1"
FT                   /translation="MMIRAYVGFDDTDCPDSDRGTGKLARWFQRELPEGCNVWGVVRQQ
FT                   LLVHDDIPYTSHNSSACVIVEMPDAGLLDDLASRAARHLERHSLEGSDPGLCVACDGDP
FT                   SLAGLVAFGQRCTRQVVKQKDAMRAARNMHLSGHGGTNDGIIGAAAAVGLTVHGWSGRF
FT                   IEFGTLRGLPERVRVSELERLDIMPVSLDRDGQVPGPEDLVDTRGWLRPRLWGNRPILP
FT                   VIPREKGVWESLGEKRRKGAKEAGRHLGGARQPVEESPGQSRS"
     atgatgattc gcgcttatgt gggatttgac gacacggact gccccgattc ggatcgtgga        60
     acaggcaagc tggcccgatg gttccaacgg gaattgccgg aaggctgcaa cgtgtgggga       120
     gtggtacgcc agcaactcct ggtgcacgac gacatccctt acacatcgca taacagcagt       180
     gcatgcgtga tcgtggagat gcctgacgcg ggcctccttg acgacctggc ttcgagggcc       240
     gcccggcatc tcgaacgcca ttctctggaa gggagcgatc ccgggctttg cgtcgcctgc       300
     gacggagacc cgtcattggc cggcctggtc gctttcggtc aaagatgcac ccggcaggtg       360
     gtgaagcaga aggatgccat gcgcgccgcg cgcaacatgc atctttccgg ccacggcgga       420
     acgaatgacg gcatcatcgg ggccgccgcg gccgtcgggc tgacggttca cggatggagc       480
     ggcaggttca tcgaattcgg aacgctgcgc ggtctgccgg aaagggtccg ggtgtccgag       540
     ctcgaacgac tcgacatcat gcccgtatcc ctggatcggg acgggcaggt cccgggtccc       600
     gaagacctgg ttgacacgag aggatggctg cgcccgcgcc tttgggggaa tcgacccatt       660
     ctgcccgtca tcccgaggga gaagggcgtc tgggagtcgc tgggcgaaaa gcgcaggaag       720
     ggagcaaaag aggcgggacg ccatcttggc ggcgcccggc agcccgtgga agaatccccg       780
     gggcagtctc gttcgtga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page