(data stored in ACNUC7421 zone)

EMBL: CP000478.PE273

CP000478.PE273       Location/Qualifiers
FT   CDS_pept        complement(329911..330327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0276"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rxy:Rxyl_2392 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15977"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX5"
FT                   /protein_id="ABK15977.1"
FT                   /translation="MLHGYRSRKDMPEPKGKKARPEQGKRERYMQPSILLGLYPKPSYG
FT                   YELIQNIQRFGFVEGQAPPGMIYRHLHQLEGDGLVSSEWDTGAGPAKRMYRLTEEGRQM
FT                   LALWVEYMERQARNLSAFVEQYRSTRAAGSAEPS"
     atgcttcatg gatatagatc aaggaaagat atgccggaac cgaagggaaa aaaagctcga        60
     ccggaacagg gaaaacgcga acgctacatg cagccgtcca tcctgctggg cctttatcca       120
     aagccgtcgt acgggtatga gctcatccag aacatccaga gattcggatt cgtggagggg       180
     caggctccac cgggaatgat ctatcgacac ctgcaccagc tggaggggga tggattggtc       240
     tcgtccgagt gggatacggg ggcggggccg gcaaaacgca tgtatcgcct cactgaagag       300
     ggcaggcaga tgctcgccct gtgggtcgag tacatggaga ggcaggccag gaacctgagc       360
     gcctttgtcg agcaataccg ctcaacccgc gcggccggaa gcgccgagcc gtcctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page