(data stored in ACNUC7421 zone)

EMBL: CP000478.PE277

CP000478.PE277       Location/Qualifiers
FT   CDS_pept        333984..334586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0280"
FT                   /product="protein of unknown function DUF1287"
FT                   /note="PFAM: protein of unknown function DUF1287; KEGG:
FT                   hch:HCH_06899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15981"
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX9"
FT                   /protein_id="ABK15981.1"
FT                   /translation="MLLAATVPLSAAQESPESRVVRAAREQVGKTIRYDPGYEKLAYPG
FT                   GDVPLERGVCSDVVVRAYRAALQMDLQKLVHEDMILNFGGYPRLWGLKRPDSSIDHRRV
FT                   PNLQTYFKRMGYALPVTREAKDYKPGDLVTCTLPPNLPHIMIVSDRTNAGGVPLVIHNI
FT                   GAGAKEEDRLFEFPLTGHYRIKTNEPRVRRSVQGRAR"
     atgctgctgg ctgcgacggt tcctttgagc gcggcccagg agagcccgga aagccgcgtg        60
     gtcagggctg cccgcgaaca ggtcggcaag acgattcgct acgaccccgg ctacgaaaag       120
     ctggcgtatc cgggcgggga tgttcccttg gagcggggcg tatgcagcga cgtggtagtg       180
     cgtgcgtatc gcgcggcact ccaaatggat cttcaaaaac tggtccacga agacatgatc       240
     ctcaactttg gcggctaccc ccggctctgg gggttgaaac gcccggacag cagtatcgac       300
     catcgacggg tgcctaacct gcagacctat ttcaagagga tgggatatgc ccttcccgtc       360
     acgagggagg ccaaggacta caagcccggg gatctcgtca cctgcactct cccgccgaac       420
     ctgcctcaca tcatgatcgt cagcgacaga acgaatgccg gaggagttcc cctggtcatc       480
     cacaatatcg gagccggggc caaagaggaa gaccggctgt tcgagttccc gctgaccggg       540
     cactacagaa tcaagacgaa cgaaccgcgg gttcggcgca gcgtgcaggg ccgcgcccgc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page