(data stored in ACNUC7421 zone)

EMBL: CP000478.PE278

CP000478.PE278       Location/Qualifiers
FT   CDS_pept        335354..337420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0281"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ana:alr1229 two-component sensor histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15982"
FT                   /db_xref="GOA:A0LEY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY0"
FT                   /protein_id="ABK15982.1"
FT                   /translation="MQDEEKSREQLIRELEEMRRRLGRQDKELAELKGMEEALRESAGR
FT                   YRQMAENIREVFWMADLQESRMLYISPAYEGVWGRTCDSLYANPTSWMEGIHPADRERV
FT                   DELLAQRASGGYSVEYRVVRPDGSVRWVLDRGFPISDAAGTPYRIAGIAEDITDRKNVE
FT                   AELHEYRDRLEDLVKERTADLARANEQLTHEIEERKKAEQKLRESQQMLQSVLDTIPVR
FT                   VFWKDFDSNYLGCNGPFARDAGLQSPEEIVGKNDLVMIWADLAELYRADDRMVMETGRP
FT                   KLGYEEPQTTPSGGRVWLRTNKVPLLDSEGRIKGVLGTYEDITESKRIEEMLRVSETKY
FT                   RIVADNTHDWEYWMSPEGRFLYISPSCERITGYPAGAFEADPRLLSRIVHPDDVNRFNA
FT                   HVAMDRTAHTRHGLEFRIINRDGATRWIGHLCQPVFDEKDCFMGRRGSNRDITDRKLAE
FT                   EALQDSAEKLKLFAYSVAHDLKSPAIGIYGLTKRLNRNYRSLLDEKGKVCCDQILRTSE
FT                   HIAALVDKINVYIATKEAPLAIEEINIAEIIRMLRDEFSAQLSLRRIDWLEPEARIEIR
FT                   ADRVAMLRAFRNFVDNSLKYGGEKLSTIQTGYEESEDFHIFSFSDNGKGLKEGDAERIF
FT                   GAFQRNPASKGVEGAGLGLAIVKEIAAQHSGRVWVEPRAKRGITFCMSISKNL"
     atgcaggacg aagagaaaag cagggagcaa ctcatccgtg aactggagga gatgcgccgg        60
     cgcctgggcc ggcaggataa ggaactggcg gagctgaaag gcatggagga agctctgcgg       120
     gaaagtgccg ggcgataccg ccagatggcg gaaaacataa gggaggtctt ttggatggcc       180
     gacctccagg agagccggat gctgtatatc agccccgcct acgagggggt gtggggccgc       240
     acatgcgaca gcctctatgc gaatcccacg tcctggatgg aagggataca cccggccgat       300
     cgggagaggg ttgacgagct actggcgcaa agggccagcg ggggatacag cgtcgaatac       360
     cgggtcgtgc gtcccgacgg ttcggttcgc tgggtgctgg accgcgggtt tcccattagc       420
     gatgcggcag ggacgcccta tcgtattgcg gggatcgcgg aggacataac cgaccgcaag       480
     aatgtggaag cggaacttca tgaataccgc gaccgcctgg aggatctggt gaaggagcgc       540
     accgccgatt tggcgagggc gaacgaacag ctcacgcacg aaatcgaaga gcggaagaag       600
     gccgaacaga agctgcgcga atcgcagcaa atgctgcagt ccgtcctgga caccattccc       660
     gtaagggtat tctggaagga cttcgattcg aactacctgg gctgcaacgg cccgtttgcg       720
     cgcgacgcgg gtctgcagtc gccggaagag atcgtgggga agaacgacct tgtgatgatc       780
     tgggcggacc tggcggagct ctaccgcgcg gatgaccgca tggtgatgga aaccggcagg       840
     ccgaaactcg gatacgaaga gccccagacg acgccgtccg gcggccgggt atggctgcgc       900
     acgaacaagg tccccctgct cgattccgaa ggcaggatca aaggcgtcct cgggacttac       960
     gaagatatta ctgagagtaa gcgtatcgag gaaatgctgc gggtttccga aaccaagtac      1020
     agaatagtcg ccgacaacac gcacgactgg gaatactgga tgagtcccga gggccggttc      1080
     ctgtacattt ctccgtcctg tgaaaggatc accggctacc cggcgggcgc gttcgaggcg      1140
     gatccccggt tgctttcccg catcgttcac cccgacgacg tcaaccgttt caacgcccac      1200
     gtggccatgg atcggacggc gcatacacga cacgggctgg agttccgcat catcaatcgg      1260
     gatggggcga cgcggtggat cggacacctc tgccaaccgg tgttcgatga aaaggactgc      1320
     tttatgggcc gccgcgggag caaccgcgac atcaccgacc gaaagctggc ggaggaagcg      1380
     cttcaggaca gtgcggaaaa actgaagctg ttcgcctatt ccgtcgccca cgatctcaag      1440
     agtccggcga tcggcatcta tggcctgaca aaacgactga acaggaatta caggagcctc      1500
     ctcgacgaaa aagggaaggt ctgttgcgat cagatcctga ggacttcgga gcacatcgct      1560
     gccctggtcg acaagatcaa tgtctacata gcgacgaagg aagcccccct tgccattgaa      1620
     gaaatcaaca ttgcggaaat catcaggatg ctgagggacg agttctccgc gcaactgagc      1680
     ctgcgccgca tagactggct cgaacccgag gcccggattg aaatcagggc ggatcgcgtg      1740
     gccatgctga gggccttcag gaatttcgtc gacaactcat tgaaatacgg aggggaaaag      1800
     ctgagcacga tccagaccgg gtatgaggaa tcggaggatt tccacatctt ttcattcagc      1860
     gataacggaa aaggtttgaa agagggggat gccgaaagaa tcttcggggc gtttcaacgg      1920
     aatccggcct cgaaaggagt cgagggggcg ggattgggcc tcgccatcgt gaaggaaata      1980
     gcggcgcaac acagcggccg ggtgtgggtg gaaccgaggg cgaaaagggg aatcacgttc      2040
     tgcatgtcca tctccaagaa cctgtaa                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page