(data stored in ACNUC7421 zone)

EMBL: CP000478.PE279

CP000478.PE279       Location/Qualifiers
FT   CDS_pept        complement(337655..338125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15983"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY1"
FT                   /protein_id="ABK15983.1"
FT                   /translation="MLKIEIPGCEPLHLSDLVLDYNGTIAASGRLIDGVKERLEVLSQS
FT                   LDIHVLTADTFGSVRSELSEAVCRLYVIPPGNQAQAKVDYVRRLGCEGVVCVGNGRNDT
FT                   LMLGEAALGIAVIQSEGAFSRAVLSADVVTTDILDALDLVIHPLRLAATLRA"
     atgctgaaaa ttgagatccc cggctgtgag cccttgcact tatcggacct ggtcctggat        60
     tacaatggaa cgatcgcggc cagcggccgg ttgatcgatg gagtgaaaga gcgcctggag       120
     gttctttcgc agtccctgga cattcacgtc ctcacggccg acaccttcgg aagcgttcgc       180
     agcgagctct cggaggccgt ttgccggctt tacgtcatac cgcccggcaa tcaggcgcag       240
     gccaaggtgg attatgtacg gcggctggga tgcgagggag tggtctgcgt cgggaacggg       300
     cgaaatgaca cgctgatgct cggggaggcc gccctgggaa tcgcggtgat tcagtccgag       360
     ggcgccttca gccgtgccgt tctttccgcg gatgtcgtga cgaccgacat actcgatgcc       420
     ctggatctgg tcatccatcc gttgaggctc gccgcaacgc tgcgcgcatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page