(data stored in ACNUC7421 zone)

EMBL: CP000478.PE280

CP000478.PE280       Location/Qualifiers
FT   CDS_pept        complement(338235..339017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dvu:DVU2664 phosphate ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15984"
FT                   /db_xref="GOA:A0LEY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY2"
FT                   /protein_id="ABK15984.1"
FT                   /translation="MENNVIDQQVEPSVTIRGLSVRFSERTVLDRISFTACPGRIIVIV
FT                   GPSGSGKTTLLRAVNRLNECFPNCRTEGSVELRLNGRDGDIYRDFVPLPDLRRNVGMVF
FT                   QTPSVLPFSTRKNLAMPLKVTLGLDGARLSERVEWALREVSLWDEVKDRLHADASTLSG
FT                   GQQQRLCLARVLALEPQILLLDEPTASLDFKATEKIEELLTRLKKRYTILAVSHSLSQT
FT                   RRLADRVCVLREGRIVRELDHQHLQDLNEFQRLVEDAF"
     atggaaaaca acgtgatcga ccaacaggtg gaaccttccg tgaccatacg gggtctttcg        60
     gttcggtttt cggagagaac cgttctggat cggatcagct tcactgcctg ccccggccgg       120
     atcatcgtga tcgtcggccc ttccgggtcg ggaaaaacaa cccttctgcg ggccgtcaac       180
     cggctgaacg aatgcttccc caactgccga accgaaggtt ccgtggagct tcgcctcaac       240
     ggcagggatg gggacatcta ccgggacttc gttcccctcc cggatctgcg caggaacgtc       300
     ggaatggttt tccagacccc gagcgttctt cccttttcaa cgaggaagaa cctggccatg       360
     ccactcaagg tgacgctagg cctggacggc gcgaggctct ccgagagagt ggaatgggct       420
     ctgcgtgaag tctcgttgtg ggatgaggtc aaagacaggc tgcacgccga tgcgtccact       480
     ctttcaggcg ggcagcagca gcgactgtgc cttgcaaggg tcctggcgct cgagccgcag       540
     attctcctcc tcgatgagcc gacggcctcc cttgacttca aggccaccga aaagatagaa       600
     gagcttctga caaggctgaa gaagcgctac accatcctgg ccgtctctca cagcctgagt       660
     caaacgcgac gactggccga cagggtctgc gttctcaggg agggccggat tgttcgggaa       720
     ttggaccatc agcacctgca agacctgaac gagttccaga ggcttgtcga ggatgccttc       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page