(data stored in ACNUC7421 zone)

EMBL: CP000478.PE281

CP000478.PE281       Location/Qualifiers
FT   CDS_pept        complement(339002..339880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0284"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dvu:DVU2665
FT                   phosphate ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15985"
FT                   /db_xref="GOA:A0LEY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY3"
FT                   /protein_id="ABK15985.1"
FT                   /translation="MKTAADLLLTAYAWFCAIAVFLATSFLLGFLFKRGMGVMHPSLFF
FT                   GDTPWFSALLGASPVFEGIWPALVGTLALVLVSSVMAIPVGIASGIYLSEYASARVRSM
FT                   LGFAVDVLSGTPSIVMGLFGFTMILFLRKTALPQARPSLFLAAVCIALLILPYVIRTTQ
FT                   TAMEAIPEHLRLLGPSLGLTRWHHVRHVLLPSASRGILSGAILALGRASEDTAVIMLTG
FT                   VVARAGLPASLWDKFEALPFRIYTLAAEHRSVQELDQGFGMALVLLLMTGSLFAVASFL
FT                   QRSLEKRWKTT"
     atgaaaacgg ccgctgatct tctcctgacc gcatatgcct ggttttgcgc gattgcggtt        60
     tttctcgcga cttcgtttct gctcggtttc ctgttcaagc ggggaatggg cgtcatgcac       120
     ccgagcctct tttttggtga taccccgtgg ttttcagcgc tcctgggggc aagccccgtg       180
     ttcgaaggaa tatggccggc actcgtgggg accctggccc tggttctcgt ttcgtcggta       240
     atggccatcc cggtcggcat tgcaagcggc atctatcttt ccgaatacgc gtcggcgcgc       300
     gtccgttcca tgctcgggtt tgccgtggat gttctgtccg gtaccccatc catcgtcatg       360
     gggctgttcg gattcacgat gatcctcttc cttcgcaaaa ccgcattgcc gcaggccaga       420
     ccgtcccttt tcctcgcggc ggtttgtatc gcgctgctca tcctgcccta cgtgattcga       480
     acgacgcaga cggccatgga agccataccc gagcacctca ggctgcttgg tccgagcctg       540
     gggcttaccc gttggcacca cgtccgacac gtgctgttgc cgtcggcaag ccggggaatc       600
     ctgagcggcg ccatcctcgc cctggggaga gcgtccgagg acacggccgt tatcatgctg       660
     accggcgtcg tggcgcgcgc cggccttccc gccagcctgt gggacaagtt cgaggcgctg       720
     cccttccgca tatacaccct ggcggccgag caccggagcg tccaggaact ggatcagggt       780
     ttcggcatgg ccctggtgct cctgctcatg acgggcagcc tttttgccgt cgcgtctttt       840
     cttcaaagaa gcctcgaaaa acgatggaaa acaacgtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page