(data stored in ACNUC7421 zone)

EMBL: CP000478.PE282

CP000478.PE282       Location/Qualifiers
FT   CDS_pept        complement(339864..340748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lip:LI1029 phosphate
FT                   transporter permease PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15986"
FT                   /db_xref="GOA:A0LEY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY4"
FT                   /protein_id="ABK15986.1"
FT                   /translation="MNHVQLVRERWIRRSLLIATGISAGAILFIFVLLVYFCLPLITSG
FT                   GMSSVLSWQWKPFAGEFGILPMCAGSLLLSVFALGLAFPAAIGICGFATVLAARSLARF
FT                   TLVLVHFMTSIPTVIYGFVSVFLLVPLVRDWFSTGTGFSFLTAGLSLSLLILPTIVLVF
FT                   HARLQQIDPALRLAAEAMGLTPVRQFLHVLVPAASRGLVVAAILGFGRAIGDTLISLML
FT                   AGNAPRIPDSLFDSIRTLTAHIALVLATDSQSMSYRSVFASGLILFLLMGAANFFIRRM
FT                   DRGPGENRYENGR"
     gtgaatcatg ttcagctggt ccgcgagaga tggatccgaa ggagtcttct gatcgccacg        60
     gggatatccg cgggcgcgat ccttttcatc ttcgttctcc tcgtctattt ctgcctgcct       120
     cttatcacct cgggcgggat gagctccgtt ctttcgtggc agtggaagcc tttcgcaggt       180
     gagttcggaa tcctgcccat gtgcgcgggc tcgctgttac tttcggtatt cgccctggga       240
     ctggcgttcc ccgcggccat aggcatctgc ggcttcgcga ccgtccttgc cgccaggagc       300
     cttgcccgtt tcaccctggt cctggtccac ttcatgacaa gcattccgac cgtcatttac       360
     ggcttcgttt ccgtcttcct ccttgttcct ctcgtgcggg actggttcag caccggaacc       420
     ggcttctctt tcctgaccgc gggactctct ttgagtctgc tcatcctgcc gaccatcgtc       480
     ctggtgttcc atgcccggtt gcagcagatc gatcccgccc ttcgtcttgc cgcggaggcc       540
     atgggactga cgccggtccg ccagtttctg cacgtgcttg ttcccgcggc atcgaggggc       600
     cttgtcgttg cagcgatact gggatttgga cgggccatcg gcgacaccct gatttccttg       660
     atgcttgccg gcaacgcgcc ccggattccg gattctctct tcgattccat ccggacgctc       720
     acagcccaca tcgccctggt cctcgcaacg gacagtcaga gcatgtctta ccgatccgta       780
     tttgcttcgg gcctgattct tttcctgctg atgggcgccg ccaatttctt tattcgcagg       840
     atggaccgcg gtcccgggga gaaccggtat gaaaacggcc gctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page