(data stored in ACNUC7421 zone)

EMBL: CP000478.PE283

CP000478.PE283       Location/Qualifiers
FT   CDS_pept        complement(340790..341635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0286"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   dvu:DVU2667 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15987"
FT                   /db_xref="GOA:A0LEY5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY5"
FT                   /protein_id="ABK15987.1"
FT                   /translation="MGIQKRRVDGVVILAVCFFFGLMQGVAFCGALDGFSGLEGTIAIA
FT                   GGTAHIPVMNDAAKNIMTVNPGIRITVEGGGSGVGVQKVGEGLADIGNTGRALSELEIA
FT                   KYGLKSFAFALDGVAAAVHPENPVSDLSPQQVRDIFAGSITNWKAVGGMDAPIHLFCRD
FT                   EASGTREVFWEKLLKKGPVAATANIVASNGAMKVAISQDKNAIGYVGIGHVDQSLKALK
FT                   LEGIAATQENAMNGSYPVVRKLYMNTRGEPSKLVRTFIDYVMGPECADIIKKYGYIPLK
FT                   "
     atgggtatcc agaaaaggcg cgttgatggg gttgtcatac tggcggtttg cttcttcttc        60
     ggtctcatgc agggtgttgc tttctgcggc gctttggatg gattctcagg cctcgaagga       120
     accatcgcca tcgccggcgg cacggctcac atacccgtaa tgaacgacgc ggcgaagaac       180
     atcatgacgg tcaaccccgg gatccgaatc accgtcgaag gcggaggatc gggggtcgga       240
     gtccagaagg tcggggaagg gctcgcggat attggaaaca ccggccgggc gctttccgag       300
     ctggagatcg ccaagtacgg cttgaagtcc ttcgctttcg ccctcgacgg agtggcggcc       360
     gcggtccatc cggaaaaccc cgtcagtgac ctgtcccctc aacaggtgcg ggatatcttt       420
     gccgggtcga tcaccaactg gaaagccgtc ggcgggatgg acgcccccat tcatcttttc       480
     tgccgggatg aggcaagcgg cacacgcgag gtcttctggg aaaagctgct gaagaaaggc       540
     ccggttgccg ccacggccaa catcgttgca tccaacgggg cgatgaaggt cgcgatttcc       600
     caggataaaa acgccatagg atacgtgggt atcgggcatg tggaccagag ccttaaagcc       660
     ctcaagctgg agggcattgc ggcaactcag gaaaatgcga tgaacggaag ttatcctgtg       720
     gttcgaaagc tttacatgaa caccaggggg gagccttcca agcttgtcag gaccttcatc       780
     gactacgtca tgggtcccga atgcgccgat atcatcaaaa agtacggata catcccactg       840
     aagtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page