(data stored in ACNUC7421 zone)

EMBL: CP000478.PE285

CP000478.PE285       Location/Qualifiers
FT   CDS_pept        complement(343847..344731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0288"
FT                   /product="4-hydroxybenzoate polyprenyltransferase,
FT                   putative"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase,
FT                   putative; PFAM: UbiA prenyltransferase; KEGG: gme:Gmet_3393
FT                   4-hydroxybenzoate polyprenyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15989"
FT                   /db_xref="GOA:A0LEY7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY7"
FT                   /protein_id="ABK15989.1"
FT                   /translation="MRESERVAMLLTRIRTYGRLIKFSHTIFALPFALAAVLLANRHQP
FT                   VSWATLAWIVLAMASARSAAMGFNRLADYEFDRRNPRTSDRPLTSGAIDRKSVLCFIFI
FT                   SSSVFVLSAAALGRLCFVLSVPVLLVLFFYSYTKRFTAFSHLVLGFGIGLAPIGAWIAV
FT                   TGSLTPGIVLLSLALMTYIAGFDILYACQDIDFDRQSGLFSLPARWGASRALTASSLLH
FT                   AATFLCLLAVTFAFSLGRVYLLFLALISLLLIIEHLLVRPDRLDRVNVAFFHVNSAISV
FT                   LLFVGILADVAVY"
     ttgagggaga gtgaacgcgt cgccatgttg ctcactcgaa tcagaaccta cggtcgattg        60
     atcaaattca gccacacgat cttcgcgctc ccgttcgctc tcgccgccgt tttgctcgca       120
     aaccgccacc agcccgtttc ctgggcgacc ctggcgtgga tcgtgctcgc catggcgtcg       180
     gcccgttccg ccgcgatggg attcaaccgg ctggcggact acgaattcga ccgaaggaac       240
     ccgcgcacat ccgacaggcc tctgacgtcg ggagccatcg accggaagtc ggtactctgc       300
     ttcatcttca tttcgtcgtc ggtcttcgta ttgagcgccg cagcccttgg ccgactgtgt       360
     ttcgttctct ccgtgcccgt tctgctcgtc ctgttcttct attcctacac gaagcggttc       420
     acggcgttct cgcacctcgt gctcgggttc ggcatcggcc ttgctcccat cggagcctgg       480
     atcgccgtca ccgggtcgct gacgccgggc atagtcctgc tctcgctggc gctcatgacc       540
     tacatcgcgg gcttcgacat tctctacgcc tgccaggaca tcgacttcga caggcagtcc       600
     ggtctttttt cactgcccgc caggtggggc gcatccaggg cactgaccgc ctcctccctg       660
     ctccatgccg cgaccttcct ctgcctgctc gcggtcacct tcgccttcag cctcggtcga       720
     gtctacctcc tgttcctggc cctcatcagc ctgctgctca ttatcgaaca ccttctcgtc       780
     aggccggatc gactcgacag agtaaacgtc gccttctttc acgtgaacag cgcaatttca       840
     gttctgctgt tcgtcggaat cctggcggac gtggccgtct attag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page