(data stored in ACNUC7421 zone)

EMBL: CP000478.PE288

CP000478.PE288       Location/Qualifiers
FT   CDS_pept        349445..350029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15992"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ0"
FT                   /protein_id="ABK15992.1"
FT                   /translation="MVGLLLLASSGCGSRKQVQIPSEWRTPPSATTQAQRAPAAVPPST
FT                   APPPAPGLILKPPPQFKEKDVEPGLETIQPPVPEKKQAVVHPPQHLASMHLVDQARAEL
FT                   SRGRPDAAIPVLEQAVQVDVHNGDAFLGLARAWKMKGARRKAVEFAKKAEVLFQDDSRK
FT                   LKEAYLLEAELYRELGDTNKSNLYKQKASEL"
     gtggtcgggc tcctgttgct ggcgagttcc ggatgcgggt ccaggaaaca ggtccaaatt        60
     ccgtccgaat ggcgtacgcc tccctccgca acaacccagg ctcaacgcgc gcccgccgcc       120
     gttccgccgt ccacggcacc tccacccgcg ccgggtttga tcttgaaacc gccgccgcaa       180
     ttcaaggaaa aggacgtcga acccggactg gagacgatcc agccgcccgt gccggagaag       240
     aagcaggcgg tcgtccatcc gccccagcat ctggcttcca tgcacctggt ggaccaagcc       300
     agggccgagc tctcgagggg aaggccggat gcggccatac ccgtcctgga acaggcggtc       360
     caggtggatg tgcacaacgg agacgccttc ctcgggctgg ctcgtgcctg gaagatgaaa       420
     ggagctcgcc ggaaggccgt cgaattcgcc aagaaagccg aagtgctctt tcaggacgac       480
     tccaggaaac tgaaggaggc gtatctcctc gaggccgagt tgtacaggga actgggggat       540
     acgaacaagt ccaacctcta taagcagaaa gcgtccgagc tgtga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page