(data stored in ACNUC7421 zone)

EMBL: CP000478.PE29

CP000478.PE29        Location/Qualifiers
FT   CDS_pept        42222..43301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0030"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: ferredoxin; 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein; molybdopterin oxidoreductase Fe4S4
FT                   region; KEGG: sat:SYN_00630 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15733"
FT                   /db_xref="GOA:A0LE81"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE81"
FT                   /protein_id="ABK15733.1"
FT                   /translation="MKDDIITLKVNGKDFKGREVKGKKGQTVLEVLRANDVHVPTLCYH
FT                   PQMPPYGGCRLCIVEIENMRGLPPSCTTPATDGMVVNTHSPKVVGVRKTVLELLLAYGD
FT                   HNCLLCEQTGSCELQNLVYEHGIDHVRIKSQFVPKIKDDSHPMIVRDHNKCVLCGRCVR
FT                   ACLQVQVNGAIDVAARGSDSYITTFNNTNLMESNCVSCGQCVQACPVGALTEKKSRFKG
FT                   RAWEMEKVRTTCPYCGVGCQMWLHVKDGRIVKVTGVEDGAPNEGRLCVKGRFGYDFIYS
FT                   EERLKTPLIKENGAFREASWDEALDLVAKKFTEIKKKHGPDAIAGVSSSRSLNEDSYQM
FT                   QKLFRAVIGTNNIDNCART"
     atgaaagacg atatcatcac tctcaaggtc aacgggaagg atttcaaggg aagggaggtc        60
     aagggaaaaa aagggcagac ggtcctcgaa gttcttcggg ccaacgacgt tcatgtgccc       120
     accctgtgct accatcccca gatgccaccc tacgggggat gcagattgtg catcgtcgaa       180
     atcgagaaca tgcgcggtct cccgccttcc tgtaccaccc ccgcaaccga cgggatggtt       240
     gtgaacacgc actcacccaa ggtggtcggg gtgcgtaaaa cggtgctgga actgctcctc       300
     gcctacgggg accacaattg cctgctgtgc gagcagacgg gcagctgcga gctccaaaac       360
     ctggtttacg agcacggcat cgaccatgtt cgcatcaagt cgcaattcgt tcccaagatc       420
     aaggacgatt cacatccgat gatcgtccgc gaccacaaca agtgcgtgct gtgcggccgc       480
     tgcgtcaggg cctgcctgca ggtgcaggtg aacggcgcca tcgatgtcgc ggctcgcggt       540
     tcggattcct acatcacgac gttcaacaac accaacctga tggaatccaa ctgcgtttcc       600
     tgcggtcaat gcgttcaggc atgcccggtg ggtgccctga ccgagaaaaa gtcgaggttc       660
     aagggccggg cgtgggagat ggaaaaggtc cgcacgacct gcccctactg cggcgtgggc       720
     tgccagatgt ggctgcacgt caaggacggc cggatcgtca aggtcacggg ggtcgaggac       780
     ggcgctccca atgaaggccg gttgtgtgtg aagggccgct tcggttatga cttcatctat       840
     tcggaagagc ggctgaagac gcctttgatc aaggaaaacg gtgcgtttcg tgaggcttca       900
     tgggacgagg cgctcgatct ggtcgcaaag aagttcacgg aaatcaagaa aaaacacggt       960
     ccggacgcca tcgcgggggt gagctcgtcg cgcagcctca acgaagactc ctaccagatg      1020
     cagaagctgt tccgcgcggt gatcggaacc aacaacatcg acaactgcgc acgtacctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page