(data stored in ACNUC7421 zone)

EMBL: CP000478.PE290

CP000478.PE290       Location/Qualifiers
FT   CDS_pept        complement(351433..351750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15994"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ2"
FT                   /protein_id="ABK15994.1"
FT                   /translation="MEQKIVSERLYVKIDETGKLVEASYLPMVDSRIEPVPTPLIPAAT
FT                   TKSASFQINEEGIIVEASPPNLNGHKLVLHAKSDSALGRTDAVTPKRVWVPDGKGGWIC
FT                   V"
     atggaacaga aaatcgtgag cgagagactt tacgtcaaga tcgacgagac gggaaagctt        60
     gtcgaggcat cctacctgcc catggtcgat tcccgcatcg agccggttcc gacaccgctc       120
     atccccgcgg ccacgacgaa aagtgccagt ttccagatca atgaagaggg gatcattgtt       180
     gaggcttctc cgccgaatct caacggtcac aagctcgtgt tgcacgcgaa gtccgattcg       240
     gccctcggaa ggaccgatgc ggttacgccc aagagggtgt gggtcccgga cggcaaaggg       300
     ggttggatct gcgtgtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page