(data stored in ACNUC7421 zone)

EMBL: CP000478.PE297

CP000478.PE297       Location/Qualifiers
FT   CDS_pept        complement(361984..362787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0300"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: chy:CHY_0576 putative keto/oxoacid
FT                   ferredoxin oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16001"
FT                   /db_xref="GOA:A0LEZ9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ9"
FT                   /protein_id="ABK16001.1"
FT                   /translation="MSRAASIRPKTLTAARFHYCPGCGHGVAHRLVAEVIDELGLREKT
FT                   VGVASVGCSVLIYNYLDLDMQESPHGRAPAVATGIKRVLPDRIVFTYQGDGDLASIGLS
FT                   EIVHAAARGENITVIFINNANYGMTGGQMAPTTLPGQKTTTSPAGRDVTRAGYPLRMAE
FT                   LLAGLDGPVYIARAALYNPAQVVRAKKCIRKAFLCQERGMGFSLVEILSSCPNNWGMEP
FT                   TAALRWVETQMTARYPLGVFKDATVPTVRGDTAGSREDSSPEPGK"
     atgagccgag ccgcttctat tcgtccgaaa acgttgacgg cagcgaggtt tcactattgt        60
     cccggctgcg gccacggggt ggcgcaccgg cttgtcgcgg aagtcatcga cgagctcggc       120
     ctgcgggaaa agacggtcgg cgtggcttcc gtgggatgtt cggtcctgat ctacaactac       180
     ctggacctgg acatgcagga atccccacac ggccgggcgc ccgccgtggc cacgggaatc       240
     aagcgggtgc tcccggaccg gatcgtgttc acttaccagg gcgacggaga cctggcctcc       300
     atcggattgt cggaaatcgt ccatgcggcg gcgcgcggcg agaacatcac cgtgattttc       360
     atcaacaatg caaactatgg catgaccgga ggccaaatgg ccccgaccac gctgcccggg       420
     cagaagacga cgacttcgcc cgccggcagg gacgtaaccc gggccggata tccgctgcgg       480
     atggccgagc tccttgcggg gctggacggg cccgtctaca tcgcgcgggc ggccctctac       540
     aacccggcac aggtggtccg ggcaaagaag tgcatcagga aagcctttct gtgccaggaa       600
     cggggcatgg ggttctccct ggtggaaata ctctcgtcct gccccaacaa ctggggaatg       660
     gaaccgaccg cggcgttgcg ttgggtcgag acgcagatga ccgctcgcta cccgcttggg       720
     gttttcaagg acgcgacggt gccgacggtc cgcggcgaca cggccggcag ccgggaagac       780
     tcgtcgccgg aaccgggaaa gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page