(data stored in ACNUC7421 zone)

EMBL: CP000478.PE299

CP000478.PE299       Location/Qualifiers
FT   CDS_pept        complement(363833..364105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0302"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: sth:STH221 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16003"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF01"
FT                   /protein_id="ABK16003.1"
FT                   /translation="MFAARDLAFETRKRHTFKPVIHADRCKGCGICAAFCPEKILVPGS
FT                   HLNAHGYPVVKLVKGALCSGCRRCVLMCPDLAITFAHEENGSCAS"
     atgtttgcag ctcgagacct tgcattcgaa accaggaagc gtcacacgtt caagccggtg        60
     atccacgccg accggtgcaa gggttgcggc atctgtgcgg cattctgccc ggagaagatt       120
     ctcgtgcccg gcagccattt gaatgcccac ggctatccgg tggtgaagct ggtcaagggc       180
     gcgctctgca gcggctgccg ccgttgcgtc ctgatgtgcc ccgacctggc catcaccttc       240
     gcccatgagg agaacgggtc atgcgcgtca tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page