(data stored in ACNUC7421 zone)

EMBL: CP000478.PE30

CP000478.PE30        Location/Qualifiers
FT   CDS_pept        43350..44936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0031"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: sat:SYN_00629 formate
FT                   dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15734"
FT                   /db_xref="GOA:A0LE82"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE82"
FT                   /protein_id="ABK15734.1"
FT                   /translation="MTNSFGDFARAKLILAIGTNMTEAHPVASSFVKNAVQNGGELIVV
FT                   DPRRTGLADHASQHLQLRVGSDIALLNGLMHVLITEDLYDKEYVKNCCTGFDELKKKVM
FT                   EYPPERAAEISGVDAETIRQVARKLATVRPAMLAYTLGITEHTCGMNNVLSCANLQMLL
FT                   GNVGFECGGVNPLRGQNNVQGACDMGALPNVFPGYQQVADPKARAKFEAAWNVKGLPDK
FT                   PGLMMPQMMDGLASGKVKAFYIFGENLANTEPDIRHVEHCLDSAEFLVCNDIFPTETTR
FT                   FADVVFPVAAWSENDGTFSNSERRVSRVRTVSEPPGVAKPNWWVFKEIARRMGQEWASS
FT                   SAQELWDNEISVLAPALGGIKYRRIEKDGLQWPAPTEEHPGTPTLHRDGKFTCGLGNLV
FT                   PVDWTPPAEVPDKEYPFVLSTGRRLFHYHTRTQTGRCEGLNDLLGEETADMSREDGIAM
FT                   GIQVGDKVRVKSRRGEVVVTANPTDRVPKGMVWMAFHFRDGCANWLTNPVFDPVTQTAE
FT                   YKACAVKIEKA"
     atgacgaact cgttcggcga ttttgcgcgg gcgaaactga ttctggccat aggcaccaac        60
     atgacggaag cgcaccccgt ggcttcgagt tttgtgaaga acgcggtgca gaacggtggg       120
     gaactgatcg tggtggatcc gcgccgcacg ggccttgccg atcacgcttc ccagcacctc       180
     caactccgcg tgggcagcga catcgcgctc ctcaacggcc tgatgcacgt gctcatcacg       240
     gaggatctct acgacaagga atacgtcaag aactgctgta cgggttttga cgagctgaaa       300
     aagaaagtca tggagtatcc gccggagcgg gcggccgaga tctccggggt cgacgccgag       360
     accatccggc aggtcgcgcg caagctcgcc acggtgcgcc cggccatgct ggcttacacg       420
     ctgggcatca ccgaacacac ctgcggcatg aacaacgtgc tgtcctgcgc gaacctgcag       480
     atgctcctcg gcaatgtggg attcgaatgc ggcggcgtca acccgttgcg cggccagaac       540
     aacgtgcagg gagcctgcga catgggcgct ctgcccaatg ttttccccgg gtatcaacag       600
     gtggcggatc ccaaggcgag ggcgaagttt gaagcggcct ggaacgtcaa gggacttccc       660
     gacaaacccg gtctgatgat gccgcagatg atggacggcc tggcgtcggg gaaggtcaag       720
     gccttttaca tcttcggtga gaacctggcc aataccgagc cggacatccg gcacgtggag       780
     cactgcctgg attcggccga attcctggtc tgcaacgata tcttcccgac ggagacgacg       840
     cgctttgcgg acgtcgtatt tccggtcgct gcctggagcg agaacgacgg aaccttcagc       900
     aacagcgagc ggcgggtgag ccgggtgcgg accgtgagcg aaccgccggg tgtggccaag       960
     cccaactggt gggttttcaa ggaaatcgcc cgacgcatgg gacaggagtg ggcgtcttca      1020
     agcgcgcagg aactgtggga caatgaaatc tcggtgctgg ctccggctct tggcggaatc      1080
     aagtatcggc gcatcgagaa ggatggtctg cagtggcccg cgccgaccga agaacatccg      1140
     ggaacgccga ccttgcatcg ggacggcaag ttcacctgcg gactggggaa tctggttcct      1200
     gtggactgga cacccccggc ggaggtgccg gacaaggagt atccgttcgt gctcagcacg      1260
     ggccggcggc tgttccacta ccatacgcgg acccagacgg gaaggtgtga gggattgaac      1320
     gaccttctgg gcgaagagac ggccgacatg tcccgggaag acggcatcgc catgggaatt      1380
     caggtcggcg acaaagtccg ggtgaaatcg cgccgcgggg aagtggtggt tacggccaat      1440
     cccaccgacc gcgttccgaa gggcatggtc tggatggcct tccatttccg cgatggctgt      1500
     gccaactggc tgaccaaccc ggtcttcgat ccggtcacgc agaccgcgga atacaaagcc      1560
     tgcgcggtca agatcgaaaa ggcctga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page