(data stored in ACNUC7421 zone)

EMBL: CP000478.PE301

CP000478.PE301       Location/Qualifiers
FT   CDS_pept        366463..367569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0304"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_1312 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16005"
FT                   /db_xref="GOA:A0LF03"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF03"
FT                   /protein_id="ABK16005.1"
FT                   /translation="MTIRTRAAVVRRRGGPFLFEDVEIDDPRADEALVRMVACGICHTD
FT                   IAGRDGALGVPLPAVFGHEGAGVVECVGSRVGRFRAGDKVVLSFSSCGECPGCLGGHPA
FT                   RCGEFDALNFGGARPDGSSTIRDAKGAPLGSSFFGQSSLAGYATVRERGLVGVEAVDED
FT                   ELTILAALGCGIQAGAGTVLNELKPRRGESIAIFGAGTVGLAALMAARLAGAAPIVVVD
FT                   VVASRLELALELGAAVAIDGRAGDVVEHLRETAGSIDHAVETTGVSRVIDCAMKALGSR
FT                   GNISLLAVSADEGEERVHPKSRDPGQSVIYSVAGDSDPQTFIPFLIRKHKEGAFPFERL
FT                   IRIYPASRINEAVKDSLSGITVKPVLRF"
     atgacgatcc gcactcgtgc tgcggtggtc cgccggcgtg gcgggccgtt cctgtttgaa        60
     gatgtcgaga tcgacgatcc gcgcgcggat gaggccctcg ttcgaatggt tgcctgcggc       120
     atctgccaca cggacatcgc cgggcgcgac ggggcgctgg gagtgccgct tcccgccgtg       180
     ttcgggcacg agggcgcggg cgtcgtggaa tgcgtcggca gtcgagtggg ccggttccgt       240
     gccggggaca aagtggtgct ctcgttcagt tcctgcgggg agtgccccgg ctgtcttgga       300
     ggtcatccgg cccgatgcgg ggagttcgac gcgttgaatt tcggcggcgc gagacccgac       360
     ggttcttcga caatccggga tgcaaagggt gccccgctgg gaagctcttt ctttggtcag       420
     tcttcgcttg ccgggtatgc cacggtccgg gaacgagggt tggtgggggt ggaagccgtc       480
     gatgaggacg aactcacgat ccttgccgcc ctgggatgcg gcatccaggc cggggccggg       540
     acggtactga acgagttgaa gccccggcgg ggggaatcga ttgcgatctt cggcgccggc       600
     acggtcggcc tggcggcact catggccgcc cgcctggctg gagccgcgcc catcgttgtc       660
     gtggacgtgg tggcatcccg attggagctg gccctggaac tgggagcggc cgtcgccatt       720
     gacggccgcg cgggagatgt ggtcgagcac ctgcgcgaaa cggcgggaag catcgaccac       780
     gccgtcgaga ccacgggtgt ctcgcgggtg atcgattgcg ccatgaaggc cctgggctca       840
     aggggcaata tatcgttgct cgcggtttcc gctgatgaag gggaggagcg tgtccatccg       900
     aaatcacgcg accccggcca gtccgtcatt tacagcgtcg cgggcgacag cgatccgcaa       960
     acgttcattc ctttcctgat ccgcaagcac aaggaaggcg catttccctt cgagaggctg      1020
     atacgcatct acccggcgtc aaggatcaac gaagcggtga aggattccct gtccgggatc      1080
     acggtcaagc cggtgttgcg gttctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page