(data stored in ACNUC7421 zone)

EMBL: CP000478.PE304

CP000478.PE304       Location/Qualifiers
FT   CDS_pept        370587..370901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16008"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF06"
FT                   /protein_id="ABK16008.1"
FT                   /translation="MAFLVSLSCPVAENLSDNQGNTEAQGDLYRKNEQIKRELACRKIL
FT                   DDAVRFLHDLTGLCRVHLAPPTDSVRDPCSASYISSQPICKLIILSDRKTSRPESDQQV
FT                   "
     gtggccttcc tggtgtcgtt gtcgtgcccg gttgccgaaa atctctcaga taaccagggc        60
     aataccgaag cacagggcga tctctaccgc aaaaacgaac aaataaaacg cgaacttgcc       120
     tgccggaaga tcctcgatga tgcggttcga ttcctgcatg acctgactgg cttgtgccgt       180
     gtccaccttg ctcctccgac cgattccgtt cgtgaccctt gctctgcttc atatatcagt       240
     tcgcaaccga tatgtaaatt gattatattg tcggatcgaa aaacttcaag acctgaaagc       300
     gaccaacagg tgtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page