(data stored in ACNUC7421 zone)

EMBL: CP000478.PE308

CP000478.PE308       Location/Qualifiers
FT   CDS_pept        complement(373875..374588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0311"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_2427 ABC branched-chain amino acid
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16012"
FT                   /db_xref="GOA:A0LF10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF10"
FT                   /protein_id="ABK16012.1"
FT                   /translation="MNFFQTHRLVKAFGGLLAVNDLTFEVEKGEIYGLIGPNGSGKTTV
FT                   FNLITGYYPITSGYIEFQGKRLNGLPTWRVCKQGIGRTFQIVKPLRRMTVLENVMTSAF
FT                   NRTSREAEAREKALEVLDFCELTKKQDYPAKGLTIGDRKRMEIARALATAPELLLLDET
FT                   MAGLTPQEQADGVQLIRKVRNSGITIIIVEHIMHVIMNLCDRILCINYGQEIARGTPAE
FT                   VANNQAVIEAYLGKE"
     atgaattttt ttcaaacaca tcgtctcgtc aaggccttcg gcggcctgct cgccgtcaac        60
     gacctgactt ttgaggtcga gaaaggggaa atatacggct tgatcggtcc aaacggttcc       120
     ggcaagacga ccgttttcaa cctgatcacc ggttactacc cgatcacttc cggttacatc       180
     gagttccagg ggaagagact caacggcctg ccgacctgga gggtctgcaa gcagggcatc       240
     gggaggactt tccagatcgt gaagcccctg cgtcgaatga cggtgctcga aaacgtcatg       300
     acctccgcct tcaacaggac ttcacgggag gcggaagccc gtgaaaaagc cctggaagtg       360
     ctggatttct gcgaactgac caaaaagcag gactatcccg caaaaggcct caccatcggc       420
     gaccgcaagc gcatggagat cgcgcgggcg cttgccaccg cccccgagct gctcctgctg       480
     gacgaaacca tggccggcct gacgccccag gagcaggccg acggcgtcca actgatccgc       540
     aaggtccgca attccggaat cacgatcatc attgtcgaac acatcatgca cgtgatcatg       600
     aacttgtgcg accgcatcct ttgcatcaac tacggtcagg agatcgcacg aggaacgccg       660
     gcggaagtgg ccaacaatca agccgttatc gaggcgtatc tgggaaagga atag             714
//

If you have problems or comments...

PBIL Back to PBIL home page