(data stored in ACNUC7421 zone)

EMBL: CP000478.PE309

CP000478.PE309       Location/Qualifiers
FT   CDS_pept        complement(374591..375571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0312"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gsu:GSU2007
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16013"
FT                   /db_xref="GOA:A0LF11"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF11"
FT                   /protein_id="ABK16013.1"
FT                   /translation="MKSIRWSTLVILLLLAVFPLVIQSDYYRHILIIALMWVVIGSSWN
FT                   LLSGYTGQVSFGHAIFFGIGAYTAGLCTTQLDISAWYGMLLGGPVALLIGLVIGWICFR
FT                   LRGPYFALATIAVGEIFRLVATEWVDFTEGMQGILIIQTFRSKIPYYYLALGLAAACIY
FT                   SIHTVMNSKWGYYFLAIREDQDAAEALGISSFRYKSLSLMISAFFTGLAGAFYMNYMAF
FT                   IDPQVVFSLHFISIMAILVGIIGGVGTLWGPPTGAFIMVLLQETFRSAFFGMLPKWVSE
FT                   AHVLVFGLLVIFVIRYMANGIVGDWGKIRQVFSGRKASPSAGSGN"
     atgaaatcaa ttcgttggtc gacgcttgtc atccttttat tacttgccgt ttttcccctc        60
     gtgatccagt ccgattacta ccggcacatc ctcatcattg cgctcatgtg ggtggtcatc       120
     ggatcatcat ggaatctgct gtccggttat acgggacagg tctcgttcgg ccatgccatt       180
     tttttcggca tcggcgccta cacggcgggg ctgtgcacga cccagctcga catatcggca       240
     tggtacggca tgctgctggg aggaccggtc gcccttctca tcgggctcgt catcggatgg       300
     atctgtttcc gtctgcgcgg cccttacttt gccctcgcga ccatcgcggt gggcgagatc       360
     ttccggctgg tcgccacgga gtgggtcgac ttcacggagg gcatgcaggg catcctcatc       420
     atccagacat tccggagcaa gattccttac tattacctgg ccctcggtct ggcagccgca       480
     tgcatttatt ccatccacac ggtcatgaat tcaaagtggg gttactactt cctggccatc       540
     cgggaagacc aggacgccgc cgaagccctg gggatcagca gttttcgtta caagagcctc       600
     tcccttatga tcagcgcctt tttcaccggt cttgccggtg ccttttacat gaactacatg       660
     gcgttcatcg accctcaggt ggtcttttcg ctccacttca tctccatcat ggccatcctc       720
     gtgggaatca tcggcggcgt gggaaccctc tggggcccgc cgacgggtgc ctttatcatg       780
     gtcctgctcc aggagacatt ccggagcgcc tttttcggca tgcttccgaa gtgggtcagt       840
     gaggcccacg tcctggtttt cggattgctg gtcatcttcg tcatccgcta catggccaac       900
     ggcattgtgg gagactgggg caagatccgc caggttttct ccggccggaa agcatcacct       960
     tctgcaggaa gtggaaactg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page