(data stored in ACNUC7421 zone)

EMBL: CP000478.PE311

CP000478.PE311       Location/Qualifiers
FT   CDS_pept        complement(376540..377733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0314"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gsu:GSU2005 branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16015"
FT                   /db_xref="GOA:A0LF13"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF13"
FT                   /protein_id="ABK16015.1"
FT                   /translation="MKRMVSAIVTLSFALAFLVLPAFAQETVKVGIILPVTGEKAKFGE
FT                   IEKKSFEMALEEINAAGGINGKKLEFLLEDDTGRPDVARSAAEKLITKDKVVMLGGGYG
FT                   SSETFAIAGVAQQSRIPFLVNTGSDDKITEKKWEYIFRLNPPVSEYPKGLESFLTEVVK
FT                   PKTAVILYENTNFGSSGSKEFKATCERLGIKVLMMEGYEHGGVDFKPLLIKVKQANPDL
FT                   VYMISYLMDASLLMRQSLELRVTPKLFVGGAAGFTLPEFQKNAGKASDMVYSATLWYQT
FT                   LPYPGAKKYFDDFKKKFGVDTEYHGAEAYAAAFVIADALKRTKSMGPEDVRQALAATDM
FT                   MTVFGPVKFIAYDTMTNQNKLPTYLVQWIDGKLELVWPKDVASKPYVYPIDWEKVWK"
     atgaagcgca tggtgtcggc tattgtgact ttgtcttttg cactcgcgtt cctggtcctg        60
     ccggctttcg ctcaggaaac cgtcaaggtg ggcatcattc tgccggtcac gggagaaaag       120
     gcgaaattcg gcgaaatcga gaagaagtct ttcgagatgg ccctggagga gatcaacgca       180
     gcggggggca tcaacgggaa gaagctcgaa ttcctgcttg aagacgacac cggacgcccg       240
     gatgtggctc gttcggcggc cgagaagctc atcaccaagg acaaggtggt catgctcggc       300
     ggcggatacg ggagttccga gacgtttgcc attgccggcg ttgcgcaaca gagccgcatc       360
     cctttcctcg tcaacacggg atcggacgat aagatcacgg aaaagaaatg ggaatacatc       420
     ttccgcctga acccccccgt gagtgagtat ccgaaggggc tcgaatcctt cctcaccgag       480
     gtggtgaaac cgaagacggc ggtcattttg tacgaaaaca ccaacttcgg gtcctcgggg       540
     tccaaggagt tcaaggcgac ctgcgaacgg ctgggcatca aggtgctcat gatggaaggc       600
     tacgaacacg gcggagtgga tttcaagccc ctgctgatca aggtcaagca ggccaatccg       660
     gatctcgttt acatgatttc ctacctcatg gacgcgtcgc tgctcatgag gcaatccctg       720
     gagcttcgcg tcacgcccaa gctcttcgtc gggggggcgg cgggttttac gctgcccgaa       780
     tttcagaaga atgcgggcaa ggcctccgac atggtctact ccgcgaccct gtggtaccag       840
     accctgccct acccgggagc caagaaatac ttcgacgatt tcaagaaaaa attcggggtt       900
     gatacggaat atcacggtgc cgaggcctat gccgcggctt tcgtgatcgc cgatgcactg       960
     aaacggacca aatccatggg tccggaagat gtccgccagg cgctggccgc caccgacatg      1020
     atgacggttt tcggccccgt caagttcatc gcttacgaca cgatgaccaa ccagaacaaa      1080
     ctgcccacct acctggtgca gtggatcgac gggaagctcg agctggtgtg gccgaaggac      1140
     gtcgcctcca aaccatacgt gtatcctatc gactgggaaa aggtctggaa atag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page