(data stored in ACNUC7421 zone)

EMBL: CP000478.PE312

CP000478.PE312       Location/Qualifiers
FT   CDS_pept        377948..378937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN2451.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16016"
FT                   /db_xref="InterPro:IPR019438"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF14"
FT                   /protein_id="ABK16016.1"
FT                   /translation="MENLHESPRAFPVLESIAPVVERSRWVTFHPASAELCIERWGHLL
FT                   DSVPTWKQPWHFFDGGLETVRWVFVLDVLNHCFWPDENEPLWSVRYRGNEYSGYAGLAA
FT                   SLKRAMESGVPVTNASFLAGLSPGTLREILAGTGEIPLLEARLENLREAGRVLLARWEG
FT                   DIVNLVASAGRSAVDVVKGVVDSFSSFRDECGYRGRPVYFWKRAQLFAADLHSAFDGRD
FT                   WGAFEDIERLTAFADYKLPQVLRRFGLIVYHPELAERIERRERLPAGSEEEVEIRAATV
FT                   WAVEALKKAFERRGAEPTSMRVDGWLWQLGQLEYFRKYPYHLCRTIYY"
     atggaaaacc tgcacgaaag cccgcgcgct tttccggtgc tggagtcgat agctccggtg        60
     gtggagcgca gccgctgggt gacgttccat cccgcgtcgg cggaattgtg catcgagcga       120
     tggggacacc tgttggactc ggtccccacc tggaaacagc cctggcactt cttcgacgga       180
     ggcctggaga cggtgcgctg ggtgttcgtc ctggacgttc tcaaccactg tttctggcct       240
     gatgagaatg aaccgctctg gtccgtgcgt taccggggga acgaatattc cggctatgcg       300
     ggccttgccg cctctctcaa gcgagccatg gaaagcggcg tcccggtgac gaatgcatcg       360
     ttcctggcag gtctgtcccc gggaacattg cgcgagattt tagccggaac gggcgagatt       420
     ccgctcctcg aggcccgcct ggagaacctg cgcgaagcgg ggcgggtact gctcgcgcgg       480
     tgggaaggcg acatcgtcaa cctggttgct tccgcggggc gcagcgccgt cgacgtcgtg       540
     aaaggcgtgg tcgacagctt ctcgagcttt cgcgacgagt gcgggtatcg agggcggccg       600
     gtgtatttct ggaagagggc gcagctgttt gcggcggatc ttcattcggc attcgacgga       660
     agggattggg gggcgttcga ggatatagaa cggcttaccg cgttcgccga ctacaagctt       720
     ccccaggttc tgcgccggtt cggactgatc gtgtatcacc ccgaactggc ggaaaggatc       780
     gagaggcggg agcggctgcc tgccggaagc gaggaagagg ttgagatcag ggcggcgacg       840
     gtatgggcgg tggaagccct gaagaaagcg tttgaacggc ggggcgccga accgacaagc       900
     atgcgcgtgg atggctggct ctggcagttg gggcagctgg agtatttcag aaagtatcct       960
     taccatcttt gtcgcacgat ctattactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page